KEGG   Sulfuritalea hydrogenivorans: SUTH_02126Help
Entry
SUTH_02126        CDS       T03591                                 

Gene name
aorA
Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
shd  Sulfuritalea hydrogenivorans
Pathway
shd00030  Pentose phosphate pathway
shd01100  Metabolic pathways
shd01120  Microbial metabolism in diverse environments
shd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SUTH_02126 (aorA)
Enzymes [BR:shd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     SUTH_02126 (aorA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: BAO29916
UniProt: W0SFW2
LinkDB All DBs
Position
complement(2187210..2189057)
Genome map
AA seq 615 aa AA seqDB search
MGWTRKILRVDLSKGTCTSEPLNMEWAQQYLGQRGLATKYFVEEVDPKVDPLSPANKMIM
ATGPLTGTPASTGGRYSVITKGALTGAIACSNSGGYFGAELKFAGWDMVIFEGKSPKPVY
LSIEDDKVELRDAAHLWGKTVWQTEEIIKKSHQDPQIRVSSIGRSGENGVLYACIVNDLH
RAAGRSGVGTVMGSKNLKAVAVRGTKGAGAIKNPKAFMQAAATAKKVLADNAVTGQGLPT
YGTQVLMNVINEMGALPTRNHRDVQFEDARKISAEAMHEKRPTDGKPHLVTNAACFGCTI
ACGRISKIDETHFSVVNKPQYWGASGGLEYEAAWALGAANGVGDLEALQYANLICNEDGF
DPITFGATVAAAMELYDLGILTKEQIGLDAPFGSAQALVALAEMLVKGEGFGKDLALGSA
RLCAKYGKPELSMGVKKQEFPAYDSRGIQGMGLAYATSNRGACHLRGYTVASEVLGIPVK
TDPLVTEGKADLVKAFQDATSVFDSAGVCVFTTFAWTLADLQPQLDAACEGEWTMEKLAL
LGERVWNMERMFNNAAGFTAKDDDLPPRLKTEPAKTGPAKGLVNGIDKMRPEYYKARGWS
AEGVPSKETLARLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgggatggacacgaaagatcctgcgcgttgatctgagcaagggcacctgcacgtcggag
cccctcaacatggaatgggcgcagcaatacctcggccagcgcggactggccaccaagtat
ttcgtcgaggaagtcgaccccaaggtcgatccgctgtcaccggccaacaagatgatcatg
gccaccggcccgctcaccggcacgccggcgtcgaccggcggccgctactcggtgatcacc
aagggcgcgctgaccggcgccatcgcctgctccaattccggcggctatttcggcgccgaa
ctcaagtttgccggctgggacatggtcatcttcgaaggcaagtcgccgaagccggtttac
ctctcgatcgaggacgacaaggtcgaactgcgcgatgccgcccatctgtggggcaagacc
gtgtggcagaccgaggagatcatcaagaagagccatcaggatccgcagattcgcgtttcc
agcatcggccgctcgggcgagaacggcgtgctctatgcctgcatcgtgaacgacctgcat
cgcgccgccggccgttccggcgtcggcaccgtgatgggctcgaagaacctcaaggccgtg
gcggtgcgcggcaccaagggcgccggcgcgatcaagaatcccaaggccttcatgcaggcg
gccgcgacggcgaagaaggtgctggccgacaatgcggttacaggtcagggcctgccgacc
tatggaacccaggtgctgatgaacgtcatcaacgaaatgggcgcgttgccgacgcgcaat
caccgcgatgtgcagttcgaggatgcgcgcaagatttcggccgaggccatgcacgagaag
cggccgaccgacggcaagccgcatctggtgaccaacgccgcctgcttcggctgcaccatc
gcctgcgggcgcatttcgaaaatcgacgagacgcatttcagcgtggtgaacaagccgcag
tactggggcgcatcgggtgggctcgaatacgaagccgcctgggcactgggtgctgccaac
ggcgtcggcgacctggaggcattgcaatatgccaacctgatctgcaacgaagacggcttc
gacccgatcaccttcggcgccaccgtggcggcggcgatggagctctatgacttgggcatc
ctgaccaaggagcagatcggcctcgacgcgcccttcggttccgcccaggctctggtggcg
ctggccgaaatgctggtcaagggcgaaggcttcggcaaggatctggcgctgggttcagcg
cgcttgtgcgcaaagtacggcaagccggaactgtcgatgggcgtcaagaagcaggaattc
cccgcctacgactcgcgcggcatccagggtatgggcctggcctacgccacgtccaaccgt
ggcgcctgtcacctgcgcggctataccgtggcttcggaagtgctcggcattccggtcaag
accgacccgctggtgaccgaaggcaaggccgatctggtcaaggccttccaggacgccacc
tcggtgttcgactccgccggtgtctgcgtgttcaccaccttcgcctggacgctggccgac
ctgcagccgcaactcgatgccgcatgcgaaggcgagtggaccatggagaaactcgcgctg
ctgggcgaacgcgtgtggaacatggagcgcatgttcaacaatgccgccggctttaccgcc
aaggacgacgacctgccgccgcgtctcaagaccgagccggccaagaccggcccggccaag
ggactggtgaacggcatcgacaagatgcggccggagtactacaaggcgcgcggctggagc
gcggaaggcgtgccgagcaaggagactctggcgcggcttggtctgtaa

DBGET integrated database retrieval system