KEGG   Sulfuritalea hydrogenivorans: SUTH_02380Help
Entry
SUTH_02380        CDS       T03591                                 

Definition
(GenBank) glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shd  Sulfuritalea hydrogenivorans
Pathway
shd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:shd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SUTH_02380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shd02000]
    SUTH_02380
Enzymes [BR:shd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SUTH_02380
Transporters [BR:shd02000]
 Other Transporters
  Pores ion channels [TC:1]
   SUTH_02380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N_2 GST_N GST_C_3
Motif
Other DBs
NCBI-ProteinID: BAO30168
UniProt: W0SJC9
LinkDB All DBs
Position
2465793..2466458
Genome map
AA seq 221 aa AA seqDB search
MTTPITLCGFAVSNYYNKVKLSLLEKGVPFAEAFVMTSQKEEMLAESPMGKVPFLRTAKG
VLSESQVLTEFIEDSWPEPPLYPRDAFERAKCRELIEHLELHIELPARRLYAEAFFGGTV
SEETKQEVAVLLEKGLKSLARLARFAPFIGGDSFTHADCAAWVHLPLVSQATRKIYGRDF
LDEFLPQAKPYIKLIGERPHAQKVNEDRKAGMEAFMSKPKK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
ttgactacacccatcaccctctgcggcttcgccgtcagcaactattacaacaaggtcaag
ctctccctgctggagaaaggcgttcccttcgccgaagccttcgtcatgacttcgcaaaaa
gaagaaatgctcgccgagtcgccgatgggcaaggtgcccttcctgcgcacggcgaaaggc
gtgctcagcgaatcgcaggtgctcaccgagttcatcgaagacagctggcccgagcccccg
ctctatccgcgcgacgctttcgagcgcgccaaatgccgcgaactgatcgagcaccttgaa
ctgcatatcgaactgccggcccggcgcctgtatgcggaagccttttttggcggtacggtc
tccgaggaaaccaaacaggaagtcgcggtactgctcgaaaaaggcctcaagagcctggcg
cgactggcccgctttgcgcccttcatcggtggcgacagcttcacccacgccgattgtgcg
gcatgggtgcatctgcccctcgtcagccaggcgacgcgcaagatctacgggcgcgatttc
cttgatgaattcctgccgcaggccaagccctacatcaagctgatcggcgagcggccgcac
gcgcagaaagtcaatgaggaccgcaaagcgggcatggaagccttcatgtcgaagcccaag
aaatga

DBGET integrated database retrieval system