KEGG   Sulfuritalea hydrogenivorans: SUTH_02623Help
Entry
SUTH_02623        CDS       T03591                                 

Definition
(GenBank) phosphoglycerate/bisphosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
shd  Sulfuritalea hydrogenivorans
Pathway
shd00860  Porphyrin and chlorophyll metabolism
shd01100  Metabolic pathways
Module
shd_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:shd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SUTH_02623
Enzymes [BR:shd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     SUTH_02623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAO30405
UniProt: W0SHQ4
LinkDB All DBs
Position
2720826..2721347
Genome map
AA seq 173 aa AA seqDB search
MQLYLIRHPTPQVAMGICYGRTDLALAGDVAAAAARIAPQLPTQAPLFTSPLQRCRQLAD
ALHPAPRSDPRLREMNFGAWEMRPWNQIQREALDGWAADPLGYAPPGGESVAQLQARVQD
FVMELRREGLEHAALVTHAGVLKVIVGHSRQLPAREWMALKFEYESVICVSIQ
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtgcagctttacctgatccgccacccgacgccgcaggtggccatgggcatctgctacggc
cgcaccgacctggcgctggccggggatgttgccgccgccgcggcgcgcatcgctccgcaa
ctgccaacgcaggcgccgctgttcaccagcccgctgcaacgctgccggcaactggccgac
gccctgcacccggcgcctcggagcgacccgcgcctgcgggagatgaatttcggcgcctgg
gaaatgcggccgtggaaccagatccagcgtgaggcgctggatggctgggccgccgacccg
ctgggctatgcgccgcccgggggcgaatcggtcgcgcagttgcaggcgcgggtgcaggat
ttcgtcatggagctgcggcgcgaaggcctggagcacgccgcgctggtgacgcacgccggc
gtgctgaaagtcatcgtcggccattcgcggcaactgccggcaagggaatggatggcgctg
aagttcgagtacgagagcgtgatttgcgtaagcatccaatga

DBGET integrated database retrieval system