KEGG   Sulfuritalea hydrogenivorans: SUTH_02996Help
Entry
SUTH_02996        CDS       T03591                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
shd  Sulfuritalea hydrogenivorans
Pathway
shd00620  Pyruvate metabolism
shd00680  Methane metabolism
shd01100  Metabolic pathways
shd01120  Microbial metabolism in diverse environments
shd01200  Carbon metabolism
Module
shd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:shd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SUTH_02996
  09102 Energy metabolism
   00680 Methane metabolism
    SUTH_02996
Enzymes [BR:shd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SUTH_02996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: BAO30775
UniProt: W0SIJ5
LinkDB All DBs
Position
3119828..3122581
Genome map
AA seq 917 aa AA seqDB search
MTESTEKDAPLRDDIRLLGRLLGDTLRDQEGAESFDTVERIRQLAIRFHRNDDPAARQGL
ESLFADLPNNRTTLVARAFSYFSHLANIAEDQHHIRRARAHALAGSRSREGSLAHTVQRA
TEAGIGGKALSNFFARAEVCPVLTAHPTEVQRKSILDCQWKIARLLDERDRTELTPEERE
VHEEAIRRAVLTLWQTRMLRRAKLSVMDEVANALSFYDTTFLRELPRLYNALEDHLTKQV
ADWPGDELKPFLHPGSWIGGDRDGNPFVTAEILESAMRAQSRKSLGFLLDQLHNLGADLS
PTSVLVKISDELQALAARSPDHSPHRDDEPYRRAIAGMYARLSASARQLDGLEAPRHALG
EAAPYASAAEFAADLDILHHSLLANHSRLLARGRLRRLRRAVAVFGFHLAPLDLRQNSEV
HARTVAELLAVARPGIDYLRLDEEARIRLLQEELATPRPLAAPGIAYSDETRDELAIFRT
ARSIQQRFGKAAIQNVIISKTDGVSDILELAILLKEVGLLRPSESALDVNIVPLFETIGD
LEHSDIIMDRLLGLPVYSRLLGSRGALQEVMLGYSDSNKDGGFLTSGWSLYRAEIKLTEV
FARHGVTLRLFHGRGGSVGRGGGPSYQAILAQPQGAVQGQIRITEQGEVIASKYANPDLG
RRNLEILAAATLEATLLPHQHDNPRPEFLAAMDTLSATAFKAYRRMVYETPGFERYFWES
TVISEIAALNIGSRPASRKKTTAIEDLRAIPWVFSWAQCRLMLPGWFGFGAAISAWKEER
GVAGMALLAEMNREWGFFRTLLSNMDMVLAKSDIAIAERYSRLVKDPALRDAIFPRLKEE
WQAAIAALLEITGQTELLADNPLLKRSIRNRFPYLDPLNHLQVELLRRHRAGAVDEAVKR
GIHLTINGVAAGLRNSG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatcgactgaaaaagatgcgccgctgcgcgatgacattcgcctgctggggcga
ctcctcggcgatacgctgcgcgaccaggaaggcgccgaatccttcgacacggtcgagcgc
atccgccaactggcgatccgctttcatcgcaacgacgatcccgccgcccggcagggcctg
gagtcgctcttcgccgatttgccgaacaaccggaccacgctggttgcgcgcgccttcagc
tatttctcgcacctggcgaacattgccgaagaccagcaccacatccgtcgcgcccgcgcc
cacgccctggccggatccagatcgcgcgaaggcagtctcgcgcatacggtgcagcgcgcc
accgaagccggcatcggcggcaaggcgttgtcgaacttcttcgcccgcgccgaggtctgc
ccggtactgacggcacatccgaccgaagtgcagcgcaagagcattctcgactgtcagtgg
aaaatcgcccggctgctggatgagcgcgatcgcaccgaactcacgccggaggagcgcgag
gtgcacgaagaagctatccggcgcgccgtgctgacgctgtggcagacgcggatgctgcgc
cgggccaagctctcggtgatggacgaggtggcgaatgccctctccttctacgacaccacc
ttcctgcgcgaactgccccggctttacaacgcgctcgaagatcatctgacgaagcaggtt
gccgactggccgggtgacgaactcaagcccttcctccatcccggttcatggatcggcggc
gaccgcgacggcaatcccttcgtcaccgcggagattctggaaagcgccatgcgtgcccag
agccgcaagtcgctcggcttcctgctcgatcaattgcacaacctgggtgccgacctgtct
cccacatccgtactggtgaagatttccgacgaactgcaggcactcgcggcgcgctcgccc
gaccacagcccgcatcgcgacgacgaaccttatcgccgcgcgatcgccggcatgtatgcg
cgactgtcggccagcgcacgccagctcgacggcctcgaagcgccgcgccatgcgctcggc
gaggccgcgccctacgcctctgccgccgaattcgccgccgacctcgacatcctccatcac
tcgctgctggccaaccactcgcgcctgctggcccgcggccgcctgcgacgcctgcggcgc
gccgtggcggtgttcggcttccacctggcgccgctcgacctgcgccagaactccgaagta
cacgcccgcaccgtcgccgaactgctggccgtcgcccgtcccggcatcgactatctgcgc
ctcgacgaagaggcgcgcattcgcctgctgcaggaagagctcgccacgccgcgccccctt
gccgctcccggcatcgcctattcggacgagacgcgcgacgagctggcgattttccgcacc
gcgcgctcgattcagcagcgcttcggcaaggccgcgatccagaacgtgatcatttccaag
accgacggtgtctcggacatcctcgaactcgcgatcctgctgaaggaagtcggcctgctg
cggccgagcgagagtgcgctggacgtcaacatcgtgcccctgttcgaaacaatcggtgac
ctcgaacattctgacatcatcatggatcgcctgctcggcctgccggtctacagccggctg
ctcggcagccgcggcgcgctgcaggaagtcatgctcggctattcggacagcaacaaggac
ggcggcttcctgacgtccggctggtcgctctaccgcgccgaaatcaagctcaccgaggtc
tttgcgcgccacggcgtcaccctgcgcctgttccacggccgcggcggttccgtcggccgt
ggcggcggccccagctatcaggccatcctcgcccagccgcaaggcgccgtccaaggccag
atccgcatcaccgaacagggagaagtcatcgcctcgaaatacgccaaccccgatctgggt
cgacgcaatcttgaaatccttgccgcggcgacgctggaagcaaccctgctgccgcatcag
cacgacaatcctcggccggaattcctcgcggcgatggacacgctctcggccacggctttc
aaggcttaccggcgcatggtctacgagacacccggcttcgagcgctatttctgggaatcc
accgtgatttccgagattgccgcgctcaacatcggcagccgccccgcctcgcgcaagaag
accacggcgatcgaggacctgcgggcgattccgtgggtattttcctgggcgcagtgccgc
ctgatgctgccgggatggttcggcttcggcgccgcgatctccgcgtggaaggaagaacgc
ggcgtggccggcatggcgctgctggcggaaatgaaccgcgaatggggcttcttccgcacc
ctgctctccaacatggacatggtgctggccaagagcgatatcgcaatcgccgagcgctat
tcccgactggtgaaagacccagccctgcgcgacgcgatcttccccaggctgaaggaagaa
tggcaggcggccatcgcggcattgctggagattaccggccagaccgaactgctggccgac
aacccgctgctgaagcgttcgatccgcaaccgcttcccctatctcgacccgctcaaccac
ctgcaggtggagttgctgcgtcggcatcgcgccggcgccgtggatgaagcggtgaagcgt
ggcatccacctgaccatcaacggcgtcgcggccggcttgcgcaacagtggttaa

DBGET integrated database retrieval system