KEGG   Shewanella sp. MR-4: Shewmr4_1321
Entry
Shewmr4_1321      CDS       T00388                                 

Definition
(GenBank) DegT/DnrJ/EryC1/StrS aminotransferase
  KO
K20429  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
she  Shewanella sp. MR-4
Pathway
she00541  O-Antigen nucleotide sugar biosynthesis
Brite
KEGG Orthology (KO) [BR:she00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    Shewmr4_1321
Enzymes [BR:she01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     Shewmr4_1321
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase SelA
Other DBs
NCBI-ProteinID: ABI38400
LinkDB
Position
1531231..1532340
AA seq 369 aa
MTNKTIPVTQPFLPELSEFMPYLEQIWDNRWLTNNGPFHQELEAKLAEYLGVEHVSLFNN
ATIALITALQAMRIHGEVITTPYSFVATSHSIMWNGLEPVFVDIHPTTFNIDPAKIEAAI
TPRTTAIMPVHCYSNPCDVEAIQKIADNYGLKVIYDAAHAFGVNYKGESLLKWGDLSILS
FHATKVFNTFEGGAIISPDAKTKQRIDRLKNFGIADELTVTAPGINGKMSEINAAFGLVQ
LKHIDDAMAQRQAVDSRYRCELAEVTGITLYQHDINANSNFSYFPILVEAEYPLSRDELY
EKLKANGILSRRYFYPLISNMPMYRGLPTADTVHLPLANALAEKVLCLPIFNELTVEQQQ
QVIALIKGS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgacgaataaaacaattcctgtcacccagccatttttgccagaattaagcgaatttatg
ccttatcttgaacaaatttgggataatcgctggctgaccaacaatggcccgtttcatcaa
gaattagaagccaagttggctgaatatttgggtgttgagcatgtctctttatttaataat
gccactattgcgctcatcaccgccttgcaggcgatgcgcattcacggcgaggtgattacc
actccctattcgtttgtggcaaccagccattcgatcatgtggaatggcttagagccagtg
tttgtcgatattcatccaaccacttttaatattgatcctgccaagatagaagcagcgatt
actccacgcaccactgccattatgccggtccattgctactccaatccgtgtgatgttgag
gctattcaaaaaattgccgataactatggccttaaggtaatttatgatgcggctcatgct
tttggggtcaattataaaggtgagagtttacttaaatggggtgacctgtcgattttaagc
tttcacgccaccaaggtatttaataccttcgaaggtggagcgatcatcagcccagatgcc
aaaaccaagcaacgtattgaccgcttaaaaaactttggtatcgccgatgagctaacagta
acagcgcctggcattaacggtaaaatgagtgaaattaatgccgcctttggtttagtgcag
ctgaaacatattgatgatgcaatggcgcagcgccaagccgtcgattcgcgttaccgctgt
gagcttgctgaggtaacgggcattaccctgtatcagcatgatatcaatgctaatagcaac
ttctcttacttccctatcttagtggaggcagaataccctctcagccgcgatgagctatac
gaaaagctaaaagctaatggtattttatcgcgccgttatttttacccgcttattagcaat
atgcctatgtatcggggtttaccaactgccgatactgttcatttacctctggccaatgca
ttggctgaaaaggtattgtgtttgccgattttcaatgagctaactgttgaacagcagcaa
caggttattgcattaattaaagggagttag

DBGET integrated database retrieval system