KEGG   Shewanella sp. MR-4: Shewmr4_2520Help
Entry
Shewmr4_2520      CDS       T00388                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
she  Shewanella sp. MR-4
Pathway
she00250  Alanine, aspartate and glutamate metabolism
she00410  beta-Alanine metabolism
she00430  Taurine and hypotaurine metabolism
she00650  Butanoate metabolism
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
she01120  Microbial metabolism in diverse environments
she02024  Quorum sensing
Module
she_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:she00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Shewmr4_2520
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shewmr4_2520
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shewmr4_2520
   00430 Taurine and hypotaurine metabolism
    Shewmr4_2520
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Shewmr4_2520
Enzymes [BR:she01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Shewmr4_2520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase P53_tetramer
Motif
Other DBs
NCBI-ProteinID: ABI39591
LinkDB All DBs
Position
3000758..3002407
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQATASEDSLMRIFTVPEDAESTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPSQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYAQNDDFYRNWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGDFKGVTREGLIKALRHYGFDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTDGNNKVDVAKMREVAAELANKRIKVMAIVGVAGTTETGNIDPLRELAALASEL
NCHFHVDAAWGGASLLSNKYRHLLDGIELADSVTIDAHKQMYVPMGAGMVLFKNPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIDAHPDFELVTAPELCLLTYRYVPSNVQAAMQLAIEQGDKTKLARYNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQPTVVFRVVLANPLTSHEILNQVLIEQGEIAALDKEFL
PALLAMVNE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaactccctcgccaagccaccgcgtctgaagacagtttgatgcgaattttc
actgtgcccgaagatgcggaatccaccttaagcattatcgagcagaagctttccgaggac
ttagcgggctttttgggtgacagcattgccgcgctagaaaagccgctttccgaaatcgaa
accgattttcaagcctttgaaattccaagccagccgcgttttgtctccgactacaccgac
gaaatcatgcaaaacctcgtggcgcattcggtgcatacggcggcccccagttttatcggc
catatgacctcggcactgccctatttcgtgttgccactgtcgaaaatgatggtggggctg
aatcaaaacttggtcaaaatcgaaacctccaaagcctttacgccgcttgagcgccaagtg
ctcggcatgatgcaccatttgatttacgctcaaaacgatgatttttatcgtaattggatg
cacagcgccaaccattccctcggcgcattttgctccggcggcactgtggctaacatcacc
gccctgtggattgcccgcaaccaattactcaaggccgatggcgactttaaaggcgtgacc
cgcgaaggcttaatcaaggcgctgcgccactatggcttcgatgatttagcgattctggtc
tccgagcgcggccactactccttaggtaaggccgtcgatctgctcggtatcggtcgcgac
aatatcatcagcatccctaccgatggcaataacaaagtcgacgttgccaaaatgcgcgaa
gtcgccgccgaactggcaaataaacgcattaaagtcatggcgattgttggggtggctggc
accaccgagacgggcaatatcgaccctctgcgcgaacttgccgccttagcaagtgagcta
aactgccacttccatgtggatgcggcttggggcggcgcaagcttattatccaataaatac
cgtcacttactcgatggtattgaactcgctgattcagtcaccatcgatgcccataagcaa
atgtatgtccccatgggcgcgggcatggtgttatttaaaaatcctgagtttgcccatgcg
attgcccaccacgccgaatatattctgcgccgaggttccaaggatttaggcagccaaacg
ctcgaaggctcacgccccggcatggcgatgttagtgcacgcctgtttgcagattatcggc
cgcgatggttacgaaatcctgatcaataacagccttgaaaaagcgcgttattttgccgag
caaatcgacgcacacccggactttgaactagtcaccgcaccagagctgtgcctgctcacc
tatcgttatgtgccttcgaatgtgcaggcggccatgcaactggcgattgaacaaggcgat
aagaccaaactcgctcgctataatgagctgctcgatggtctaacccaatttattcaaaaa
caccaacgcgaacagggtaaatcctttgtctcgcgcacccgaattcaacccgcgcgctac
tttagacaacccacagtggtgtttcgcgtggtattagctaatccgttgactagccatgag
atccttaatcaagtgcttatcgagcaaggtgaaattgccgcattagataaagagttttta
cctgcgctattagccatggtcaatgaatag

DBGET integrated database retrieval system