KEGG   Shewanella sp. MR-4: Shewmr4_2696Help
Entry
Shewmr4_2696      CDS       T00388                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain protein
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
she  Shewanella sp. MR-4
Brite
KEGG Orthology (KO) [BR:she00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Shewmr4_2696
Enzymes [BR:she01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Shewmr4_2696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_2 GST_N_3 GST_C_2 GST_C_3 DmpG_comm
Motif
Other DBs
NCBI-ProteinID: ABI39767
LinkDB All DBs
Position
3213347..3214015
Genome map
AA seq 222 aa AA seqDB search
MIDLYTAATPNGFKISIALEEMGLDYRVHKLDFNTNEQKQPEFLAINPNGRIPAIIDRDN
EDFVVFESGAILLYLAEKTGKFLPTDPKKRSQVIQWLMFQMSGVGPMMGQANVFYRYFPE
KIPAAIERYQKEGRRLFEVMNTQLAKHQYLAGDEYTIADIATWPWVRIHEWSGINMEGLT
HLQRWLDELAQRPACQKGIVTPPPSVLSDEERAKQIQKMVTK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttatataccgccgcgaccccgaacggttttaaaatttccatcgcgctcgaa
gaaatgggtctcgactatcgagtgcataaattagatttcaacactaacgaacagaaacag
cctgagtttctggccattaaccctaatggccgtattccagccattatcgaccgagataac
gaggactttgtggtgttcgagtccggcgcgattcttctgtatctggctgaaaaaacgggt
aagtttttgcctaccgatcctaaaaaacgctcacaggtcattcaatggctgatgttccaa
atgagcggtgttggcccaatgatggggcaagctaatgtgttttaccgttacttccccgaa
aaaatccctgcggctattgaacgttaccaaaaagaaggtcgacgtttgtttgaggtaatg
aacactcagttagccaagcatcagtatctggctggtgatgagtacaccattgccgatatc
gcgacttggccttgggtgcgcatccatgaatggagcggcatcaacatggaaggactcact
cacttgcaacgttggttagatgagctagcccaaagacccgcttgccaaaaaggcatagtg
acacctccgccttcggtcttaagtgacgaagagcgtgctaaacaaatccagaagatggtg
actaagtag

DBGET integrated database retrieval system