KEGG   Shewanella sp. MR-4: Shewmr4_3569Help
Entry
Shewmr4_3569      CDS       T00388                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
she  Shewanella sp. MR-4
Pathway
she00471  D-Glutamine and D-glutamate metabolism
she00550  Peptidoglycan biosynthesis
she01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:she00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Shewmr4_3569
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shewmr4_3569
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:she01011]
    Shewmr4_3569
Enzymes [BR:she01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     Shewmr4_3569
Peptidoglycan biosynthesis and degradation proteins [BR:she01011]
 Precursor biosynthesis
  Amino acid ligase
   Shewmr4_3569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: ABI40633
UniProt: Q0HE84
LinkDB All DBs
Position
complement(4270907..4272373)
Genome map
AA seq 488 aa AA seqDB search
MTKTERYLQLRSMIPEMRRIKRIHFVGIGGAGMGGIAEVLVNEGYVVSGSDIAQNAVTDR
LCLLGAKIHIGHGADNVQQADVVVVSTAINPENPEIIAAKELRIPIVRRAEMLAELMRYR
HGVAIAGTHGKTTTTSLIASLYGQAGRDPTFVIGGLLNSAGTNARLGTSRYLIAEADESD
ASFLHLQPMVSVVTNIEADHMDTYGGDFEKLKSTFVDFLHNLPFYGVAVVCIDDAVVREI
MPRIGRHMITYGFSDDADVQALNFQQQGHQCRFTVRRKGKEDLDLLLNLPGQHNVLNALA
AIAVATEDEIDDSAIIQALAEFQGIGRRFQHLGKFATPKGEVMLVDDYGHHPSEVAATIK
AARAGWPDKRLVMAYQPHRYTRTRDLYEDFIEVLSQVDCLLLLEVYSAGEAPIPGADGRA
LCRSIRLRGQLDPIFIASPDQLAEVLPDVLQEGDLLLTQGAGNIGALSRQLAASELGFST
AATTEVKP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacagaaagatacttacagctaagaagtatgatcccagaaatgcgccggatt
aagcgtattcatttcgtcggcattggcggcgcgggcatgggcgggatcgctgaagtatta
gtaaacgaaggttatgtcgtcagtggttctgacatcgcgcaaaatgccgtgaccgacaga
ctctgtctgctgggcgcgaaaattcatatcggccatggcgccgataacgtgcagcaagcc
gatgtggttgtggtctcgaccgcgattaatcctgagaacccagagattattgcagctaag
gaattgcgtattcccatcgtgcgccgcgccgagatgttggccgagttgatgcgttatcgc
catggtgtggcgattgcgggaactcacggtaaaaccacgaccaccagtttgattgccagt
ttgtatggtcaagcgggtcgcgatccgacctttgtgatcggtggcttgctcaacagcgca
ggcactaacgcccgcttaggaacgagtcgttatctgattgccgaagccgacgagagtgat
gccagcttcctgcacctgcaacctatggtgagcgtggtgacgaatatcgaagcagaccac
atggatacctacggtggggattttgaaaagctcaaatcgaccttcgtggactttttacat
aacctgccattctatggcgtagctgtggtgtgtatcgacgatgctgtcgtgcgcgagatt
atgccgcgtattggtcgccacatgatcacctatggcttcagtgatgatgccgacgtgcag
gcgctgaatttccagcagcagggtcaccaatgccgctttaccgtcagacgtaaaggcaag
gaagacttagatctgctgcttaacctgcctggtcagcacaatgtattaaatgcgctcgcg
gcgattgccgtggcgacagaagatgaaatcgatgatagcgccatcattcaagccttggct
gaattccagggtattggccgtcgtttccaacacttaggtaagttcgcgacgccaaagggc
gaagtgatgttagtggacgactatggtcatcaccccagcgaagtggcggcgaccattaaa
gcggcgcgtgctggctggcctgacaaacgcttagtgatggcctatcagccacacagatac
actcgtacccgtgacttgtacgaagactttattgaagtgttatctcaagtggattgcttg
ctgttactcgaggtgtatagcgcgggtgaagcgccgatccccggtgccgatggccgcgca
ctgtgccgctcgattcgtttgcgcggacagttagatcccatctttatcgccagcccagat
cagttagccgaagtgctacccgatgtgttgcaggagggggatttattgttgacccaaggt
gcgggtaatataggcgccctgtcgcgccagttagccgcctctgaattgggctttagcact
gctgcgacaaccgaggtaaaaccttga

DBGET integrated database retrieval system