KEGG   Shewanella sp. MR-4: Shewmr4_3576Help
Entry
Shewmr4_3576      CDS       T00388                                 

Definition
(GenBank) peptidoglycan synthetase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
she  Shewanella sp. MR-4
Pathway
she00550  Peptidoglycan biosynthesis
she01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:she00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shewmr4_3576
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Shewmr4_3576
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:she01011]
    Shewmr4_3576
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:she03036]
    Shewmr4_3576
Enzymes [BR:she01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Shewmr4_3576
Peptidoglycan biosynthesis and degradation proteins [BR:she01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Shewmr4_3576
Chromosome and associated proteins [BR:she03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Shewmr4_3576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer RNase_J_C
Motif
Other DBs
NCBI-ProteinID: ABI40640
LinkDB All DBs
Position
complement(4279931..4281682)
Genome map
AA seq 583 aa AA seqDB search
MTRQAKTKQASKKQKPQLIHWRLYVVVGFVFAMFSSLVGRAAYIQIIEPDKLRHESDMRT
LRTTSREVQRGLITDRNGDMLAVSVPVRAVWADPKQVNDNNGFTDMRRWQALADVLHEPV
EDVLEKVRSNPTKRFTYLKRQVTPAVADYITQLKLPGVFLKSESRRYYPGGEITAQLIGI
TNIDDVGIEGVENAYNSWLTGTPSKQKVRKSRDGHVVERLDIVQEGESPNDLVLSIDQRI
QQLAYRELKRTTEMNQATSGSIVVLDIHTGEVLAMVNTPSYNPNSRDNLQTFRMRNRAMT
DTFEPGSTIKPFVVAAALEAGTVKSTDVIPTSPGWMRLGGRQVRDATNYGDMTLARILAK
SSNVGISKLALSIPVQQLLGTYQSMGLGSFSGINLTGESAGLIQDRHRWSDFERATLSFG
YGLTATTLQLARMYATLGNGGTLYPVSILKLKKPPEGERVISQEVAHDVLQMMVGVTEKG
GTGTLAHIDGYPVAGKSGTSRKAVAGGYGDDYVALFAGVAPVNNPKLAIVVVVNEPKGDL
YYGGSVAGPAFAKVMSGALQMLNVEPISDKEQVQLAGLAGRTE
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgactaggcaagcaaaaaccaaacaggccagcaaaaagcaaaagccacaactgatccac
tggcgtttatacgtcgtggttggctttgtatttgcgatgttttcgagccttgtgggtcgt
gctgcttatatccaaattatcgagcccgataagctgcgtcacgagagtgacatgcgcacc
ctacgaaccaccagtcgtgaggtgcagcgtggcttaatcaccgaccgtaacggcgatatg
ctggcggtgagtgtgccggtgcgtgccgtgtgggccgaccctaaacaagtcaatgataac
aatggttttaccgatatgcgccgctggcaagcgctggcggacgtattacatgaacccgtg
gaagatgtgctcgaaaaggtgcgcagcaatccaaccaaacgttttacctaccttaaacgc
caagtcacacctgcggtggcagactatatcactcagcttaaattgcctggggtgttttta
aaatccgagtcacgccgctactaccctggtggtgagatcaccgcccagctgatcggcatt
accaatatcgacgatgtcggtattgaaggtgtcgaaaacgcttacaacagttggcttaca
ggtacaccatctaaacaaaaagtgcgtaaatctcgcgatggccatgtggttgagcgcctc
gatatcgttcaggaaggtgagagtccaaacgatcttgtgttgagtatcgaccaacgtatt
cagcaacttgcctaccgtgagttaaagcgcacgactgagatgaaccaagcgacctctggc
tcgatcgtggtgctcgatattcacactggcgaagtcttagccatggtgaatacgccatct
tacaaccccaactcgcgcgacaatctgcaaaccttcagaatgcgtaaccgcgcgatgacg
gataccttcgagcctggctcaaccattaaaccttttgtggttgctgcggcgttagaagca
ggcacggttaagtctaccgatgtgatcccaacctctccgggatggatgcgtttaggcggc
cgccaagtacgtgacgcaactaactacggcgacatgacactggcacgtattctggcgaaa
tccagtaacgtggggatcagtaaactcgccctgtctattccagtgcagcagttattaggc
acttatcaatccatgggtttaggcagcttctcggggattaacctcacgggtgaaagcgca
ggtttgatccaagaccgtcaccgttggtccgatttcgagcgcgccactttatctttcggc
tacggcctaacggcgaccacgctgcaactggcgcggatgtacgccactttaggcaatggc
gggactttatatccagtatcgattttaaaactgaaaaagccgcccgaaggtgaacgcgtg
atctcacaagaggtcgctcacgatgtgctgcaaatgatggtgggtgtgaccgaaaaaggt
ggcacaggtacgcttgcgcatatcgatggctacccagttgcgggtaagtctggcaccagc
cgtaaggcggtagctggcggttatggtgatgattatgttgcgttatttgctggtgtcgcg
ccagtgaataatcccaaactcgcgattgttgtcgtggtgaacgagccgaaaggcgatctc
tattatggtggttcagtggcagggccggcattcgctaaggtgatgtcaggcgcactgcaa
atgttaaatgtcgaacccatttccgataaagaacaggtgcaattggcgggactcgccggg
agaactgaatga

DBGET integrated database retrieval system