KEGG   Shewanella sp. MR-4: Shewmr4_3818
Entry
Shewmr4_3818      CDS       T00388                                 

Definition
(GenBank) periplasmic sensor signal transduction histidine kinase
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
she  Shewanella sp. MR-4
Pathway
she01503  Cationic antimicrobial peptide (CAMP) resistance
she02020  Two-component system
Brite
KEGG Orthology (KO) [BR:she00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Shewmr4_3818
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Shewmr4_3818
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:she01001]
    Shewmr4_3818
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:she02022]
    Shewmr4_3818
   01504 Antimicrobial resistance genes [BR:she01504]
    Shewmr4_3818
Enzymes [BR:she01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Shewmr4_3818
Protein kinases [BR:she01001]
 Histidine kinases
  OmpR family
   Shewmr4_3818
Two-component system [BR:she02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   Shewmr4_3818
Antimicrobial resistance genes [BR:she01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    Shewmr4_3818
SSDB
Motif
Pfam: HATPase_c HATPase_c_5 HATPase_c_2 HisKA HATPase_c_3 DUF975 HAMP CDT1_C Dfp1_Him1_M
Other DBs
NCBI-ProteinID: ABI40881
LinkDB
Position
4558011..4559375
AA seq 454 aa
MSKRALAWQLLNSLKTRLVLSALLFILVLLPLIGVALNDAFAEQVKSAAKNELSAYVYSV
LAVTEVENKRIFIPELVLENRFNLIQSGLYAIATTEDAEHKQNIVWHSQSFIGITPPAQF
TIPPTGKSAFAQIDLAGAPHLIYSFSVSFASLNENVPVTIHIIKDELEFQQQISQFNQQL
WTWLLILILVMLVFQLSWLIWTIRPLARFTQELHDVEQGKSTQLSSQYPTELQEVARQLN
ILLNTEQTQRKRYRNALADLAHSLKTPLAVIKSQADLSEASSEQVSNISRIISHQLKRAQ
TAAAASWHLGIKVEEVAAKLLRTLAKIYREPQIDLSGDLAPHAVFKGDEADLTEILGNLL
DNACKAAKSQVKLTVTGDAYQLQLCIEDDGPGISEVLQTQIFERGIRADSYHQGNGIGLA
IVRDLVDSYNGRISVSRSENLGGAKFTVNFTHSA
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgagtaagcgcgcgcttgcctggcaattattaaactccctcaaaactcggctcgtcctc
agtgcgctgctgtttattttggtgctgctgccgctgattggcgtcgctctcaatgacgcc
tttgccgagcaggtaaaaagtgccgctaaaaacgagctgagtgcctatgtgtattcggtg
ttagcggtgactgaggttgaaaacaaacggatttttatccccgagttggtgctcgaaaac
cgctttaacctcattcaatcaggcctctatgccattgccaccacagaggatgccgagcat
aagcagaatattgtctggcattcgcagtcctttattggcatcacgccgccggcgcagttc
actattccgccgacgggcaagagtgccttcgctcaaatcgatctcgctggcgcgccacac
cttatctacagctttagcgtgagttttgccagtctgaatgaaaacgtgccagtcactatc
catatcattaaggatgaattggagtttcaacagcaaatctcccaatttaatcaacaactt
tggacttggttgctgatcttgatcttagtgatgctggtgtttcagttaagttggttgatt
tggaccattaggccgctggcgcgctttacccaagaactccacgatgtcgaacagggtaaa
tcgacccaactcagtagccagtatccgactgagctgcaggaagtcgcgcggcaattgaat
atcctgctcaataccgagcagacccagcgcaaacgctatcgcaatgcccttgcggatttg
gcccacagcctaaaaaccccgctggcggtgattaagagtcaggcggacttaagcgaagcc
tcgagcgagcaagtgtcgaatatcagtcgtatcatcagccaccagctgaaacgcgcccaa
acggcggcggccgcttcctggcatttaggcattaaggtggaggaggtcgccgccaaactg
ctgcgaaccttggccaagatttatcgtgagccgcagattgatctcagcggcgatctggca
ccacatgccgtatttaagggcgatgaggccgatctgaccgaaattttaggtaacttgctc
gataatgcctgcaaggccgccaagtcgcaggtcaaattaaccgtcacaggcgacgcctat
cagctccaactttgtatcgaagacgacggcccggggatcagcgaagtcctgcaaactcaa
atatttgagcgtgggatccgcgccgactcttatcaccaaggcaacggcataggtttagcc
atagtgcgcgatttagtggatagctataatggccgcatttccgtatcccgttcagaaaac
ttaggcggcgccaagtttacggttaacttcacccactcggcttaa

DBGET integrated database retrieval system