KEGG   Shewanella sp. WE21: CKQ84_03235Help
Entry
CKQ84_03235       CDS       T05404                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
shew  Shewanella sp. WE21
Brite
KEGG Orthology (KO) [BR:shew00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CKQ84_03235
Enzymes [BR:shew01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CKQ84_03235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 GIDA FAD_oxidored HI0933_like DAO NAD_binding_7 Glutaredoxin AlaDh_PNT_C Thi4 FAD_binding_3 NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AVI64975
UniProt: A0A2R3ESL0
LinkDB All DBs
Position
774497..776068
Genome map
AA seq 523 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESRKSQELKSLAQDIVSLSSLVSLKEVQGERT
PAMTVINPELNTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDDIIEQIRNLPGKYAFE
TYVSLTCQNCPDVVQALNMMAAINPNITNVMIDGALFQEEVTSKNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTNAASRKADKINEKAPFEVLVVGGGPAGAAAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVSLTTDGLFELE
LASGAKLRSRTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDKTLRADDVLQRKAASMGNIKIITQAMTTEVTGDGTRVNG
LNYTDRATGESHHVALAGIFVQIGLVPNAEWLKGTIDLTPRGEIIVDERGQTSVPGIFAA
GDVTNSPFKQIIIAMGSGATASLGAFDYLIRHSDEETAATKAA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttaaaaaatcaactgcaaacctacctgcaaaacctcaagagacca
gttgaacttgtcgtgtctgcagatgagagtagaaagtctcaagaattaaaaagtttagcg
caagacattgtcagcctatcttctctggtgagcctgaaagaagttcagggcgaacgcacc
ccggcaatgacagtgattaacccagagcttaatacgcaaatcagctttgctggtctgcct
atgggtcacgaatttacgtcactcgtgctggcattactgcacacgggtggacacccaatc
aaactcagcgatgatattattgagcagatccgcaatctgccaggcaaatatgcctttgaa
acttacgtctcactgacctgccaaaactgcccagacgtagtacaggcactgaacatgatg
gcggccattaacccgaatatcaccaacgtgatgatcgacggtgccctgttccaagaagaa
gtaaccagcaaaaacattatggctgtgccttctgtctacttaaatggcgaagtgtttgca
gccggccgtatcagcattggcgagatcctcaataaactggataccaatgccgcaagccgt
aaggccgataaaattaatgaaaaagcgccattcgaagtcttagtcgttggcggcggccca
gccggcgcagcggcagctatttatgcagcacgtaaaggacttcgcaccggtattgttgcc
gacaagtttggcggacaagtggctgaaaccgtcggtatcgagaactttatttcggtcaaa
gcgaccgaaggtccaaaactagtggcaaaccttgaagcccatgtacgagactacgaagtt
gacatcatggacaaccaaaaagcggtgtcattgacgactgacggtttgttcgaacttgaa
ctggcaagcggcgctaaattacgtagccgtaccgtattgttagccacaggtgcccgctgg
cgtgaaatgaacgtccccggcgagaaagaataccgcggcaaaggcgtcgcatactgccca
cattgtgatggcccgttatttaagggcaagcgtgtggcggtgatcggcggcggtaactca
ggtatcgaagcggctatcgatcttgcgaacatagtagaacatgtgactgtgctggaattt
gataaaaccctgcgcgccgacgatgtactgcaacgtaaagcggcttctatgggtaacatt
aaaatcattacccaagccatgaccactgaagtgactggcgatggtactcgggttaatggc
ctgaactacactgacagagccactggcgagagtcaccatgtcgcacttgcaggtatcttc
gtgcagattgggctagtaccgaatgcggaatggttaaagggcactatcgatttaacccca
aggggcgaaatcatagtcgatgagcgcggccaaacctcagtcccaggtatttttgccgca
ggtgatgtcactaactcacctttcaagcaaattatcattgccatgggcagcggcgcgacc
gcatcactgggcgcatttgattacttaattcgccacagcgatgaagaaaccgccgcgacc
aaagccgcttaa

DBGET integrated database retrieval system