KEGG   Shewanella sp. WE21: CKQ84_09700
Entry
CKQ84_09700       CDS       T05404                                 

Gene name
moaC
Definition
(GenBank) cyclic pyranopterin monophosphate synthase MoaC
  KO
K03637  cyclic pyranopterin monophosphate synthase [EC:4.6.1.17]
Organism
shew  Shewanella sp. WE21
Pathway
shew00790  Folate biosynthesis
shew01100  Metabolic pathways
shew04122  Sulfur relay system
Module
shew_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:shew00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CKQ84_09700 (moaC)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    CKQ84_09700 (moaC)
Enzymes [BR:shew01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.17  cyclic pyranopterin monophosphate synthase
     CKQ84_09700 (moaC)
SSDB
Motif
Pfam: MoaC
Other DBs
NCBI-ProteinID: AVI66118
UniProt: A0A2R3ETR2
LinkDB
Position
2254990..2255466
AA seq 158 aa
MSNVFTHINADGNAHMVDVTEKAVTEREARAEAFIEMASTTLEMIMSGSHHKGDVFATAR
IAGIQAAKKTSDLIPLCHPLMLTKVEVYLEAQPEHNRVRITSLCKLSGKTGVEMEALTAA
SVAALTIYDMCKAVQKDMVISQVRLLEKRGGKSGHFKV
NT seq 477 nt   +upstreamnt  +downstreamnt
atgagcaatgtatttacccatattaatgccgatggcaatgcccatatggtcgatgtaact
gaaaaagccgttaccgagcgcgaagcccgtgcagaagcttttattgagatggcgagcacg
acactcgagatgatcatgagtggcagccaccacaagggtgatgtgtttgcgaccgcgcgt
attgcgggcattcaagccgcaaaaaaaacctcagaccttatccctctctgccatccgctg
atgctaacgaaagttgaagtctatttagaggcacaacctgaacataaccgcgtgcgtatt
actagcctgtgcaagttatccggcaaaacgggcgtagagatggaagcgttaactgcagct
tcagtggcggcgttaactatctatgacatgtgcaaggctgtgcaaaaagatatggtgatc
tcccaagtccgtctgttggaaaagcgtggcggcaagtcgggacattttaaggtttag

DBGET integrated database retrieval system