KEGG   Shewanella sp. WE21: CKQ84_10825Help
Entry
CKQ84_10825       CDS       T05404                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
shew  Shewanella sp. WE21
Pathway
shew00620  Pyruvate metabolism
shew01100  Metabolic pathways
shew01120  Microbial metabolism in diverse environments
shew01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CKQ84_10825
Enzymes [BR:shew01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     CKQ84_10825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M Malate_DH
Motif
Other DBs
NCBI-ProteinID: AVI66326
UniProt: A0A2R3EWC2
LinkDB All DBs
Position
2489473..2490717
Genome map
AA seq 414 aa AA seqDB search
MSDIRQQALDYHEFPIPGKTAVCLTKPAETSHDLALAYSPGVAEPVREIAADPDNAYRYT
NKGNTVAVITNGTAILGLGNLGPLASKPVMEGKALLFKHFANIDSTDIEITHNTPEEFIN
TVAAIADTFGGINLEDIKAPECFVIERELIARCKVPVFHDDQHGTAIVTAAGMINALEIQ
GKLISDATFVCMGAGAAAIACMTMLVKCGANRANIYMLDTKGVIHSGRTDLNEYKALFAN
DTEKRTLLDVIKGADVFLGLSGPDVIGAEEVALMADKPVIFACSNPDPEIKPALAHATRS
DLIMGTGRSDYPNQVNNVLCFPFIFRGALDVRASCINDEMKIAAVHAIASLAKEPVPASV
LKAYPNVTSLSFGPEYVLPKPMDPRLLPNVARAVAQAAIDSGVAAITTLPKYAD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattcgtcaacaagcactcgattatcatgaatttcccataccaggcaaaacc
gcagtttgccttaccaaacccgccgaaacgagtcacgatctcgccctagcttatagccca
ggtgtggctgagccagtacgcgaaatcgctgcagatcctgacaatgcgtatcgttatacc
aataaaggtaatacggttgccgtgattaccaatggtacggctatcttaggtttagggaat
ttgggccctttggcttctaaacctgtaatggaaggtaaagcattattgttcaagcatttt
gcgaatatcgattcgacagatattgagattacgcataatacgcctgaggaatttattaat
actgttgctgcgattgctgacacctttggtggtatcaatcttgaagatattaaagcgccc
gaatgctttgttatcgaacgtgaattgattgctcgttgtaaagtacctgtattccatgat
gatcaacacggcaccgcaatcgtgactgcggcgggtatgatcaatgcgctggaaattcaa
ggtaagttgataagcgacgcgacttttgtgtgtatgggcgcgggtgctgctgccatcgct
tgtatgactatgctggtaaaatgcggtgcgaatcgcgccaacatttacatgctagatact
aaaggagttattcattctggccgtacagatcttaatgaatataaagcactatttgcgaat
gataccgaaaaacgcacgcttcttgatgttattaaaggtgcagacgtatttttaggtcta
tcaggtcctgacgtcattggtgcagaagaagtcgcgctgatggccgataagccagtgatt
tttgcgtgttctaacccagatcctgaaatcaaacctgcacttgctcatgcaacgcgtagt
gatttgatcatgggtacgggtcgtagcgactatccaaaccaagtcaataacgtattgtgt
ttcccgtttattttccgtggtgcattggatgtgcgtgcgtcttgcattaatgatgagatg
aaaattgcggcagttcatgcaattgcatcactggcgaaagagcctgtgcctgcgagtgta
ttgaaggcttatcctaatgtgacgtcgctgagttttggccctgaatatgtgctgccaaaa
cctatggacccacgtttattgccaaatgttgcccgtgcggttgcacaagcggctatcgac
tctggtgtggctgcgatcaccactttacctaaatacgccgactag

DBGET integrated database retrieval system