KEGG   Shewanella sp. WE21: CKQ84_19305Help
Entry
CKQ84_19305       CDS       T05404                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
shew  Shewanella sp. WE21
Pathway
shew00473  D-Alanine metabolism
shew00550  Peptidoglycan biosynthesis
shew01100  Metabolic pathways
shew01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:shew00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CKQ84_19305
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CKQ84_19305
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CKQ84_19305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shew01011]
    CKQ84_19305
Enzymes [BR:shew01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CKQ84_19305
Peptidoglycan biosynthesis and degradation proteins [BR:shew01011]
 Precursor biosynthesis
  Amino acid ligase
   CKQ84_19305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: AVI67807
UniProt: A0A2R3EYT6
LinkDB All DBs
Position
complement(4329637..4330650)
Genome map
AA seq 337 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLMSANYFETSLAKSEQFCVLRVELDKFGQYRTAAGDDCEL
TNSREIRFRDESKAPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQFDDAAIEQTQAALALWGSIFVKAASQGSSVGCYKVDDS
DKVAGVLKDAFGYAPYVIVEKTIKARELEVAVYEYNGEVVATVPGEIICDTNTFYTFDEK
YAKNSKARTDVVAQHVSAEISEQIRAYAIKAFKGMKLRHLSRIDFFLTADNEILLNEINT
FPGSTPISMFPKMLRNHGHDFTEYLSLVINSQITAKS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagatcaacctgcttttgctgtgcggcggcggaagtgccgaacacgatatttca
ctcatgtcggccaattattttgaaacctcactggcaaaatccgagcagttttgtgtattg
cgagtcgaactggataaatttggtcaataccgcaccgctgcgggtgatgattgtgaactg
accaatagccgtgaaattcgcttccgagatgagagcaaagccccatggccggtcgattac
gtcattccctgcattcatggctatcccggcgaaacaggtgacattcaatcctattttaac
ctaatccaactgccctattttggctgtgaatccgaggctagcagtaactgctttaataag
atcaccgctaaaatgtggttctcggccttaggtattccgaataccccgtatatttttcta
aaccaattcgatgatgcagcaatagagcaaacccaagccgcattagcactatggggatcc
atcttcgtcaaagcggcctcacaaggttcctctgttggttgttataaagtcgatgacagc
gataaagtcgctggcgtgcttaaagatgctttcggctatgcgccctatgttatcgttgaa
aaaaccattaaagcccgtgagttagaagtcgcagtatacgagtacaacggtgaagtggtg
gcgacagtaccaggtgaaatcatctgtgataccaacaccttctacaccttcgatgagaaa
tacgccaaaaacagtaaagcacgcaccgatgtggtggcacagcatgtgtcggctgagatc
agtgaacaaatccgcgcctatgcaatcaaggcatttaaaggtatgaaattgcgtcacctg
tcgcgcatcgactttttcttaaccgcggacaatgagattttactaaatgaaatcaatacc
ttcccaggttccacgccgatttctatgttccccaaaatgctgcggaatcacggtcatgac
tttactgaatacttgagtctagtgattaacagccagataacagctaaatcttag

DBGET integrated database retrieval system