KEGG   Shewanella sp. WE21: CKQ84_19515Help
Entry
CKQ84_19515       CDS       T05404                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
shew  Shewanella sp. WE21
Brite
KEGG Orthology (KO) [BR:shew00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:shew01002]
    CKQ84_19515
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shew04147]
    CKQ84_19515
   04090 CD Molecules [BR:shew04090]
    CKQ84_19515
Enzymes [BR:shew01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CKQ84_19515
Peptidases [BR:shew01002]
 Metallo Peptidases
  Family M2
   CKQ84_19515
Exosome [BR:shew04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKQ84_19515
CD molecules [BR:shew04090]
 Proteins
  CKQ84_19515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AVI67840
UniProt: A0A2R3EYQ4
LinkDB All DBs
Position
complement(4377000..4378865)
Genome map
AA seq 621 aa AA seqDB search
MVISLNRRSKIALTVALALGLTACNDAQSKTDKTATAEAAVINTAPDKAQAIAFINDAEA
KMAELSIESNRAEWIYSNFITDDTAAQSAAVGEKVSAASVKFATEAAKYANVQLDPVNAR
KLNILRSALILPAPLDPAKNAELAQISSELNGLYGKGKYCFADGKCMTQPELSSLMAESR
DPAILLEAWKGWREIAKPMRPLFQREVELANEGAKDLGYANLSELWRSQYDMKPDDFSQE
LDRLWGQVKPLYESLHCYVRGELNKEYGDSVAPTTGPIPAHLLGNMWAQQWGNVYDLVAP
DNADPGYDVTELLAKKGYDEHKMVKQAEGFFTSLGFAPLPESFWARSLFVQPKDRDVVCH
ASAWDLDNLDDIRIKMCIQKTAEDFSVIHHELGHNFYQRAYKQQPFLFKNSANDGFHEAI
GDTIALSITPSYLKQIGLLEEVPDASKDIGLLLKQALDKIAFLPFGLMIDQWRWKVFSGE
ITPAQYNQAWWDLREKYQGVKAPTERSEADFDPGAKYHVPGNVPYTRYFLAHILQFQFHQ
ALCETAGDKGPVHRCSIYGNQAAGEKLNKMLELGLSKPWPEALKEVTGKEAMDAKAVLDY
FAPLKTWLDEQNTTANRQCGW
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggttatttcattgaatcgtcgcagtaaaatcgccctcacagtggcactcgcgctggga
ttaacggcctgtaatgatgctcaaagtaaaacagacaagacagctactgcagaagcagct
gtcatcaataccgccccagataaagcacaagccattgcttttattaatgatgctgaagcc
aaaatggctgaattatcgattgaatctaatcgcgccgagtggatttacagcaactttatt
accgatgataccgcggctcagtctgccgcagtcggtgaaaaggtcagcgcagcgtcggta
aaatttgcaacagaggcggctaagtacgccaatgtgcaactcgatcccgttaatgcccgc
aagctcaatatcctacgcagtgcgttaatactacccgcgccgctcgatcctgcgaaaaat
gccgagcttgcgcaaattagctcagagttaaatggcttatacggcaaaggaaagtactgt
tttgccgacggtaagtgtatgacccagcctgagctatcgagcttgatggccgaatcacgg
gatcccgcaatcttgctagaagcgtggaaaggctggcgtgaaatcgccaaacctatgcgt
cccttgtttcaacgtgaagtggaactggccaatgaaggcgcgaaggatctcggttatgcc
aacctgtctgagctatggcgcagtcaatatgatatgaagcccgatgacttttcacaggaa
ctcgaccgtctttggggccaagttaagccactttatgagtccttgcactgttatgtgcgc
ggtgaactcaataaagaatacggcgatagcgtcgcaccgaccactggccccatccctgca
cacttacttggcaacatgtgggcccagcaatggggcaatgtgtatgatctcgtcgcccct
gacaatgccgatccgggttacgatgtcactgagttactggcaaagaaaggctatgacgag
cataaaatggtgaaacaagccgaaggcttcttcacatcattagggttcgcaccattgcca
gaaagtttttgggcgcgttctctattcgtacaaccaaaggaccgtgatgtggtttgtcac
gcttcggcgtgggatctcgataatctcgacgatatccgcattaaaatgtgtatccaaaaa
actgccgaagattttagcgttatccaccacgaacttgggcataacttctatcaacgcgct
tataagcaacaaccattcctgtttaaaaacagcgctaacgacggtttccatgaagcaatt
ggtgacacaattgcactgtcgatcaccccaagctacttaaagcaaatcggcttattagaa
gaagtgcctgatgcatctaaggatatcggcctcttactaaaacaagccttagacaaaatt
gctttcttgccctttggcctgatgatagatcagtggcgctggaaagtgtttagcggcgaa
atcacgcctgcccaatataaccaagcttggtgggatctgagggaaaaataccaaggcgta
aaagcaccgactgaacgtagtgaagcagattttgatccgggtgctaaataccatgtacca
ggcaatgtaccctacacccgttacttcctagcgcatattttgcaattccaattccatcaa
gcactgtgtgaaactgcaggcgataaaggtccggtacacagatgcagtatttatggcaat
caagccgcgggagagaaactcaataagatgctcgagttaggcttaagtaaaccttggcca
gaagcattgaaagaagtcaccggcaaagaagccatggatgcaaaagcggtgctcgattac
ttcgcaccacttaaaacatggttagatgagcaaaataccaccgcaaaccgccagtgtggt
tggtaa

DBGET integrated database retrieval system