KEGG   Shewanella sp. WE21: CKQ84_20575Help
Entry
CKQ84_20575       CDS       T05404                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
shew  Shewanella sp. WE21
Pathway
shew00500  Starch and sucrose metabolism
shew01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CKQ84_20575
Enzymes [BR:shew01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CKQ84_20575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AVI68028
UniProt: A0A2R3EZB8
LinkDB All DBs
Position
4614699..4617236
Genome map
AA seq 845 aa AA seqDB search
MESSPTPQQDLHTSQNRHTQALTRRSRLALAVAASLLGIIGLAACSPTSNSATTATSVNA
APSVQQVAPGAPGKAPTWAFSGKTGIGTSYEPYTQGQYQDAKQNPISRVWFSLAQGILTE
TMYGLIHNAQLKELQFVVTGNGFVDTEKENTISSIEYLDTDANGRPQSLAYKIINKDVEG
KYQIEKHIFTDPDRDTLMMRVTFTAFEDGITPHLYVNPHIDNAGANDIGRIDTHTKNQAL
VAYTAAKDSSVMTVKSDLNFVQATTGFVGVSDGLADLADNGKLDTPYQTTSAQDKSTVGN
IAFTASYPTLIKAKPVTFNLAIGFGKDEIQSLANADASLAAGYDAVLSHYNAGWQGYLSS
LPAIANMANNTTDNGKLLYTSAMVLKAQEDKTYAGALIASLSNPWGDTVSAAVPSTGYKA
VWPRDFYQCAMAFLAMGDTQTPKVAFEYLKKVQVTEKTPGFTGTHGWFLQKTHVDGQIEW
VGVQLDQTAMPIMLGWKLWQAGVLTPDEISHWYQEMLKGAADFLISGGEVNLDWNHTQIT
PPKTQQERWEEQAGYSPSTTAAVIAGLVAASDIAKEAKDPDSSSRYLAAAKGLSDSLEKH
LVTTQGLLKNSAGVSAPYYLRLSPNGKPNTSDKLAANNGKQGLDQRQILDGGFLELVRYG
VRGATDKLINQSLQLIDNTELEPNLRLKYEFTAKDGSTIPGFRRYGNDGYGEDTVSGNNY
AESGSNSADQRGRIWPFFTGERGHFELALAQAKGELTGNNAQQTKQQLINTYVQGMETFA
NAGMMLPEQAWDGVGDATRYHYQLGQGTNSATPLAWTHAEYIKLVRSMTDGQVWDYYPIV
PAALK
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgagtcctacgccgcagcaggatctgcataccagccaaaaccgtcacacacaa
gcgttaacaagacgcagccgcctagcgcttgccgtcgccgcaagcctattagggataata
gggttagcggcctgttcacccacatcgaattcagcaacaactgccacaagtgtgaatgcc
gcgccaagtgtgcagcaggttgcgcccggcgcaccaggtaaagcgccgacttgggcattt
tcgggtaaaactggtattgggacgtcttacgagccttatacccaaggtcaataccaagat
gctaagcaaaatcccattagccgtgtttggttctccctcgcccaaggtattttaaccgaa
accatgtatggtcttatccataatgcgcagctcaaagaactgcaatttgtggtcacaggt
aatggctttgtcgataccgaaaaagagaacaccatcagcagcatagaatatttagataca
gatgctaatggtcgcccgcaatcccttgcctataaaattatcaataaagatgttgaaggt
aagtatcagattgaaaagcatatctttaccgatcccgaccgcgacactttgatgatgcgc
gtcacctttaccgcctttgaagacggcattacaccacatttgtatgtcaatccgcatatc
gataacgcaggcgccaatgatatcggccgcatcgacactcatacaaagaatcaggcgctg
gtggcctataccgccgccaaagacagtagcgtaatgacggtaaaatccgatctgaatttt
gtgcaggcaaccactggctttgtcggcgtctccgatggcctagccgatttggccgataac
ggcaaactcgatacgccctatcaaacgaccagtgcgcaagataaatcgaccgtcggcaat
atcgcctttaccgcaagctacccaacgctcatcaaagccaaacccgtcacctttaatctc
gccatcggttttggtaaagacgaaatccagagtttagccaatgccgatgccagcttagcc
gcaggttatgatgctgtgctcagccattacaatgcaggctggcagggttacctaagctca
ctgcccgccatcgctaacatggccaacaacaccacagataacggcaagctgctgtatacc
agcgctatggtcttgaaagcgcaggaagataaaacctatgccggcgcactgatcgcttca
ctttctaacccttggggcgatacggtttcggcagccgtgccgagcactggctataaagca
gtatggccgcgtgacttttaccaatgcgccatggcattcctcgccatgggtgacacgcaa
acgcctaaagtggccttcgaatacctgaaaaaagtgcaagtgaccgaaaagacgcccggc
tttacgggtacgcacggttggttcctgcaaaagacccatgtggatggccaaattgagtgg
gttggcgtacagctcgatcaaaccgccatgcctatcatgctcggctggaaactctggcaa
gcgggcgtactcacccctgatgagatcagtcactggtatcaagagatgctcaaaggtgca
gcggactttttgatcagcggcggtgaggtcaatctggattggaatcacacccaaatcacc
ccgcctaaaactcagcaagaacgttgggaagaacaagcgggttactccccctcgacaacg
gccgcagtgatcgcaggtcttgttgccgcgagtgacatcgccaaagaagccaaagatccc
gactccagcagccgttatcttgccgccgcaaaaggtttaagtgatagcttagaaaagcac
ttagtcaccactcaaggactattgaagaacagcgcaggcgtcagcgcgccctactattta
cgtttaagcccgaatggcaagccaaacaccagcgataaactggcggcaaataacggtaag
caaggtttagatcagcgtcagatcctcgatggcggatttttagaactagtacgttatggc
gtgcgcggtgcaaccgacaagctgatcaatcaaagccttcaattgattgataacactgaa
cttgaaccaaacctacgccttaaatatgagtttaccgccaaagatggcagcactatccca
ggctttagacgttatggcaacgacggctacggtgaggatacggtttctggcaataactac
gcagaatccggcagcaacagcgccgatcaacgcggtcgaatctggcccttcttcaccggc
gagcgcggtcattttgagctagcactcgcccaagcaaaaggtgagctaactggcaataac
gcgcagcaaaccaagcagcagttgatcaacacctatgtgcaaggcatggaaacctttgcg
aatgcgggcatgatgttacccgagcaagcgtgggacggtgtcggcgatgccacccgctat
cattaccaactcggacaaggcaccaactctgccacaccgcttgcttggacccatgccgaa
tacatcaaactggtgcgctcaatgaccgatggccaagtctgggattattaccctatcgtc
cctgcggcattaaaatga

DBGET integrated database retrieval system