KEGG   Shewanella sp. WE21: CKQ84_22425Help
Entry
CKQ84_22425       CDS       T05404                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
shew  Shewanella sp. WE21
Brite
Enzymes [BR:shew01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CKQ84_22425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AVI68370
UniProt: A0A2R3F099
LinkDB All DBs
Position
4998491..4999075
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIEGTDFAGKSLEDIIKTS
TGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGPVADAINAAFGSFDAFKAQFTDSAVNNFG
SAWTWLVKKADGTLAIVNTSNAATPLTDSTVTPIMTVDVWEHAYYIDYRNVRPDYLAHFW
QLVNWDFVNQNFAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattacccgcattaccatatgcaaagaacgcactagaaccacacatttct
caagaaaccatagaataccactacggcaagcaccacaacacttatgttgtgaagctaaac
ggcttaatcgaaggaactgatttcgctggcaaatctttagaagatatcatcaaaacttct
acgggtggcgtgtttaacaacgcagctcaagtgtggaaccacactttctactggaactgc
ttagcccctaatgctggcggcgaaccaacaggcccagttgctgatgcaatcaatgccgct
ttcggttcattcgacgcattcaaagcgcaatttactgattcagcagtaaacaacttcggt
agcgcttggacatggttagtgaaaaaagccgatggcactcttgctatcgttaacactagc
aatgcagcgacgccactgactgacagcacagtaacgccaatcatgacagttgacgtgtgg
gaacacgcttactacatcgattaccgtaacgtgcgtcctgactatcttgcccacttctgg
caattagttaactgggacttcgttaaccaaaacttcgcaggttaa

DBGET integrated database retrieval system