KEGG   Shewanella sp. WE21: CKQ84_23340Help
Entry
CKQ84_23340       CDS       T05404                                 

Gene name
megL
Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
shew  Shewanella sp. WE21
Pathway
shew00270  Cysteine and methionine metabolism
shew00450  Selenocompound metabolism
shew01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shew00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CKQ84_23340 (megL)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CKQ84_23340 (megL)
Enzymes [BR:shew01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     CKQ84_23340 (megL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Met_gamma_lyase GDC-P Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AVI68525
UniProt: A0A2R3F2E2
LinkDB All DBs
Position
complement(5190156..5191349)
Genome map
AA seq 397 aa AA seqDB search
MRDESGKMWKAATQVIHGGHEREAFGALVTPLYQSATFVFESAQQGGERFAGNELGYIYT
RLGNPTTAELERKMAILEGAEAAAATASGMGAVSAALLANLQMGDHLVASNAVYGCTYAL
MTTQFARFGIEVSLVDFSSVTEIEAAIKSNTKVIFCETPVNPHLQVFDLASIANIAKRHQ
LVSIVDNTFMTPLLQRPLDFGIDLVIHSATKYLNGHGDVIAGIVCGSEEQLHKVKYEILK
DIGAVISPHDAWLILRGLKTLDVRLQRHCDSAQRVAEFLAEHPSITRVFYPGLKSHQGHK
FIGQQMKRAGGVIAFELAANLEEAMAFVGYLKLFSIAVSLGDAESLIQHPASMTHSPYTP
EARAAAGIGDNLLRISIGLEDCDDIIADLNQALARLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcgagatgagtcaggcaagatgtggaaggcggcaacacaggttattcatggcggccat
gagcgagaggcctttggtgccttagtgacgccgctttaccaaagtgcgacttttgtgttt
gagtctgcacagcaaggtggtgagcgatttgcgggcaatgagctggggtatatttacacg
cgtttaggtaatccgacaactgccgagcttgaacgtaaaatggcgattttagaaggggca
gaggccgcagcagcaactgcttctggtatgggcgcagtatccgccgcattgctggctaat
ttgcagatgggcgatcacttagtggcgtcgaatgccgtatacggttgtacttatgcacta
atgacgactcagtttgcccgctttggtattgaagtgtctctagtggacttttcatcggta
acagaaatagaagcggcgatcaaatccaatactaaggtcattttctgtgaaaccccagtc
aatccgcatttgcaggtatttgatttagcgtcaattgcgaatattgctaaacgtcatcag
ttagtcagtattgtcgataatacctttatgaccccattactgcagaggccgctggatttt
ggtattgatttggtgatccacagtgcgactaaatatctcaatggtcatggtgatgtgatt
gcggggatagtgtgtggcagtgaagaacagctccataaagtgaagtatgaaattttaaag
gatattggcgctgtgatatcgccacatgatgcttggctgatcttacgcggccttaaaacc
ttagatgtgcgtttgcagcgccattgcgatagtgcccagcgcgtggcagagtttttggcg
gaacatccaagcattacacgtgtgttttatcccgggcttaaatctcatcaagggcataaa
ttcattggccagcagatgaagcgtgctggtggtgttatcgcgtttgaactggcggcaaat
ttagaagaagccatggcctttgtcggatatctaaagttgttctcaattgcggtgagtcta
ggtgatgctgaatccctgattcaacatcctgcatcgatgacgcattcaccttatacgcca
gaggcgagggctgccgctgggattggtgataatttgttgcggatctctattggtttagag
gattgtgacgacatcatcgccgacttgaaccaagcgctagctcgattagcttaa

DBGET integrated database retrieval system