KEGG   Shewanella sp. WE21: CKQ84_23565Help
Entry
CKQ84_23565       CDS       T05404                                 

Gene name
panP
Definition
(GenBank) putative pyridoxal-dependent aspartate 1-decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
shew  Shewanella sp. WE21
Pathway
shew00250  Alanine, aspartate and glutamate metabolism
shew00410  beta-Alanine metabolism
shew00430  Taurine and hypotaurine metabolism
shew00650  Butanoate metabolism
shew01100  Metabolic pathways
shew01110  Biosynthesis of secondary metabolites
shew01120  Microbial metabolism in diverse environments
shew02024  Quorum sensing
Module
shew_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CKQ84_23565 (panP)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CKQ84_23565 (panP)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CKQ84_23565 (panP)
   00430 Taurine and hypotaurine metabolism
    CKQ84_23565 (panP)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CKQ84_23565 (panP)
Enzymes [BR:shew01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CKQ84_23565 (panP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 P53_tetramer
Motif
Other DBs
NCBI-ProteinID: AVI68566
UniProt: A0A2R3F2J0
LinkDB All DBs
Position
5245194..5246843
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQATASEASLLRIFTAPEDASSTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPTQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYDQDTDFYQSWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGDFKGVSREGLLKALRHYGYDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTGSDNKVDVAKMRQAALELASKNIKVLAIVGVAGTTETGNVDPLTELAALAKEL
NCHFHVDAAWGGASLLSNKYRHLLAGIELADSVTIDAHKQMYVPMGAGMVLFKDPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIKAHEDFELITEPELCLLTYRYVPARVQAAMQLACEQADTIRIARFNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQATVVFRVVLANPLTSHDILNQVLVEQSEIAALDNEFL
PALMAMVAE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaaactccctcgccaagccaccgcatccgaagcaagtttgctgcgcattttt
actgcaccggaagatgcaagctcaacgctgagtattattgagcaaaagctctccgaggac
ttagcaggctttttgggtgatagtatcgccgcgctcgaaaaacccttgtcggaaatcgaa
acagattttcaagcctttgagatcccaactcagccgcgttttgtctccgattacaccgac
gaaatcatgcaaaatttggtggcgcattcggtacacacagcggcgccaagttttatcggc
cacatgacctctgcactgccctactttgtgttgccactgtcgaagatgatggtgggactc
aatcaaaatctggtcaaaatcgaaacctctaaggcatttacgccgcttgagcgccaagtg
ctcggcatgatgcaccatttgatttacgaccaagatacggatttttatcaaagctggatg
cacagcgccaatcattccctcggcgcattttgctcaggcggcacggttgccaacatcacg
gccctgtggattgcccgcaaccaactgctcaaggccgatggcgactttaaaggcgtcagc
cgcgaaggcttactcaaggcactacgccactatggctatgacgatttagcgattttggtc
tcagagcgcggtcactactcgctgggcaaagccgtcgatctgcttggcatcggccgtgat
aatatcatcagcattcccacgggcagcgataacaaggtcgatgtcgcaaaaatgcgccaa
gccgcccttgaacttgctagcaaaaacatcaaagtgttagcgattgttggcgtggctggc
accacagaaaccggtaatgttgacccgttgacagaattagctgcgctggcaaaagagtta
aactgccatttccatgtggatgcagcgtggggcggcgcaagtttattatccaataaatac
cgccacttactcgcaggtatcgaacttgcggactcagtcactatcgatgcccacaaacaa
atgtacgtgcccatgggcgcaggcatggtgttatttaaagatccagagtttgcccacgcc
attgcccatcacgccgagtatattctgcgccgtggttcaaaggacttaggcagccaaacg
ctggaaggttcacgccccggcatggcgatgttagtgcacgcttgcttacagatcatcggc
cgcgatggctacgaaatcttaatcaataacagccttgaaaaagcgcgctattttgccgaa
caaatcaaagcccatgaggattttgagctaatcactgagccagaactttgtctgctgact
taccgttatgtgcccgcccgcgtccaagccgccatgcagcttgcctgtgagcaagcagac
acgataagaatcgcccgctttaacgagctgctcgatggtcttactcagtttattcaaaag
caccaacgcgaacagggtaagtccttcgtctcccgcacccgcattcagccagcccgctat
tttagacaagcaaccgtggtgtttcgcgtagtactcgccaaccccctcaccagccatgac
attctcaatcaagtgctggtcgaacaaagcgaaatcgccgcattagataacgagttttta
cccgcactcatggcgatggtggctgaatag

DBGET integrated database retrieval system