KEGG   Shewanella sp. FDAARGOS_354: CEQ32_02070Help
Entry
CEQ32_02070       CDS       T04944                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
shf  Shewanella sp. FDAARGOS_354
Brite
Enzymes [BR:shf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CEQ32_02070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASF13940
UniProt: A0A1Z4A7K0
LinkDB All DBs
Position
complement(448008..448592)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIEGTDFAGKSLEEIIKTS
TGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGPVADAINAAFGSFDAFKAQFTDSAVNNFG
SAWTWLVKKADGTVAIVNTSNAATPLTDSTVTPILTVDVWEHAYYIDYRNVRPDYLAHFW
QLVNWDFVNQNFVG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattacccgcattaccatatgcaaagaacgcactagaaccacacatttct
caagaaaccattgaataccactacggcaagcatcacaacacctacgttgttaagctaaac
ggtttgatcgaaggaaccgatttcgcaggcaaatctttagaagaaatcatcaaaacttct
actggtggcgtatttaacaacgcagctcaagtttggaaccacactttctactggaactgc
ttagcgcctaacgctggcggtgagccaactggccctgtggctgatgccatcaacgcggct
ttcggctcattcgacgcattcaaagcacagtttaccgattctgcagtcaacaactttggt
agcgcttggacttggttagtgaaaaaagccgatggcactgttgctatcgtcaacactagc
aatgctgcaactcctctgactgacagcactgtgacaccaatcctgactgttgacgtgtgg
gaacacgcttactacatcgattaccgcaacgtacgtcctgactacttggcccacttctgg
caattagttaactgggacttcgtgaaccaaaacttcgtgggttaa

DBGET integrated database retrieval system