KEGG   Shewanella sp. FDAARGOS_354: CEQ32_02950Help
Entry
CEQ32_02950       CDS       T04944                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
shf  Shewanella sp. FDAARGOS_354
Pathway
shf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shf01100  Metabolic pathways
shf01110  Biosynthesis of secondary metabolites
shf01130  Biosynthesis of antibiotics
shf01230  Biosynthesis of amino acids
shf02024  Quorum sensing
Module
shf_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:shf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CEQ32_02950
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CEQ32_02950
Enzymes [BR:shf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     CEQ32_02950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ASF14092
UniProt: A0A1Z4A8E6
LinkDB All DBs
Position
complement(631661..632725)
Genome map
AA seq 354 aa AA seqDB search
MTIKTDELRTSLLAKVISPAQLASEYPLTQDAADYLVQQRREVEAIIMGEDHRLLVIIGP
CSIHDTQAALDYARRLAVLHQELKDDLCILMRVYFEKPRTIVGWKGLISDPDLDGSFEPN
KGLRIARQLLQQITELKLPIATEFLDMVNGQYIADLITWGAIGARTTESQVHREMASALS
CPVGFKNGTDGNINIAVDAVRAAKVPHIFYSPDKDGAMSVYRTHGNPYGHIILRGGKKPN
YFEQDIEQARLKLESVNVTPRVVVDFSHGNSEKNHLKQLVVAENIMAQMRAGSTAIAGIM
AESFLQEGNQKVVEGQPLCYGQSITDACLHWDDSEKLLRDLAKASRDRRELLGK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaccattaaaacagacgaattacgcacttccttattagctaaagtcatctcacctgca
caactggcatctgagtacccgttaacccaagatgcagccgattacctcgttcagcaacgt
cgtgaagttgaagccattattatgggcgaagatcatcgtctactggtgatcattggccct
tgctctatccatgatacgcaagctgccctcgactacgcccgccgtttagctgtgctgcat
caagagttaaaggacgatctctgtattttaatgcgggtgtactttgaaaagccgcgcacc
attgttggctggaaagggttaatttccgatcctgacttagatggcagctttgaacccaat
aaaggattgcgtattgcccgtcagctactacagcaaatcactgagctgaaattgccgatt
gccaccgagtttttagatatggtgaacggtcaatatattgctgatttaatcacctggggc
gctatcggcgctcgcaccactgaaagccaagtccaccgcgaaatggcctcggcactctcc
tgccctgtgggttttaaaaatggaaccgatggcaatatcaatatcgccgttgatgccgtt
cgtgccgccaaagtgccacatattttctattcaccagataaagatggcgctatgtcagtg
tatcgtacccatggcaatccttatgggcacattattttacgcggtggtaaaaaacctaat
tactttgagcaggatattgaacaagcaagattaaaacttgagtctgtcaatgtaacgccg
cgtgtggtggttgattttagtcacggtaacagtgaaaaaaatcacctaaaacaactggtc
gttgctgaaaatatcatggcgcaaatgcgtgccggtagtacggccattgccggcatcatg
gcagaaagtttcttacaggaaggcaatcaaaaagtggttgagggtcaacctttatgctac
ggccaaagcattaccgatgcctgcttacattgggatgactcagaaaaattactgcgagat
ctggctaaagcctcacgcgataggcgtgaacttctcggtaaataa

DBGET integrated database retrieval system