KEGG   Shewanella sp. FDAARGOS_354: CEQ32_05135Help
Entry
CEQ32_05135       CDS       T04944                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
shf  Shewanella sp. FDAARGOS_354
Pathway
shf00500  Starch and sucrose metabolism
shf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CEQ32_05135
Enzymes [BR:shf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CEQ32_05135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ASF14468
UniProt: A0A1Z4A9A0
LinkDB All DBs
Position
1125507..1128023
Genome map
AA seq 838 aa AA seqDB search
MASTTVPSQQARSLTDRRNLTRKPIALAIAASLIGVASLTGCSPSATNADSSTAAVIKAT
DAQIAPGAPGKAPTWAFSGKTGIGTSYEPYTQGQYQDSAQNPISRVWFSIAQGILTETMY
GLIHNAQLKELQFVITGNGFVDTEKDNTISSIEYLDTDANGRPQSLAYKIINRDVEGKYQ
IEKHIFTDPDRDTLMMRVTFTAFEAGITPHLYVNPHIDNAGANDIGRIDHQALIARTANP
HSSVMTVKSDIDFAQATTGFVGVSDGLADLADNGKLDTLYQATSSAENPTQGNIAFTASY
PVLQANQALNVNLAIGFGQDEASSLANANASLTAGYDAVLSQYNAGWHSYLQSLPAMPAM
AQSTTDNGKLLYTSAMVLKAQEDKTYAGALIASLSNPWGDTVPAVTPSTGYKAVWPRDFY
QCAMAFLAMGDTQTPKVAFEYLKKVQVSDKTPGFSGTPGWFLQKTHVDGQIEWVGVQLDQ
TAMPIMLGWKLWQAGVLSQAELNHWYQEMLKAAADFLVSGGEVNLDWNHTQITPPKTQQE
RWEEQAGYSPSTTAAVIAGLVAASDIAKAVNDSDASQRYLATAKTLNQQLEKHLVTTQGL
LTDSQGIKAPYYLRLSPNGEPNSAEQLAANNGRAGLDQRQILDGGFLELVRYGVRGATDK
LINQSLALVDNTELEDNLRLKYNFMAKDGSSVPGFRRYGNDGYGEDTITGANYAESGSNS
DNQRGRVWPFFTGERGHFELALASAKGELSGAHAQQTKQQLINTYVQGMETFANAGLMLP
EQAWDGVGNATRYQYQLGQGTNSATPLAWTHAEYIKLVRSMSDGRVWDNYPIVPEALK
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgacaacagtaccttcacagcaggctcgcagcttaactgaccgccgcaactta
actcgtaagccgattgcgctcgcaattgccgcaagccttatcggcgttgccagcttaacg
ggctgctcaccctcggccaccaatgcagactcatcaacagcggccgtcatcaaagccaca
gacgcacagattgcccccggcgcccccggcaaagccccgacctgggcgttctccggcaaa
accggtatcggcacttcctatgagccttatactcaagggcaataccaggatagcgcgcaa
aatcccattagccgcgtgtggttctccatcgcgcaggggattttaaccgaaaccatgtat
ggccttattcacaacgctcagctcaaagagttgcaatttgtgatcaccggcaatggcttc
gtcgataccgaaaaagacaacacgatcagcagcattgaatacttagataccgatgctaac
ggtcgcccacaatccttggcctataagattatcaatcgcgacgttgaaggtaagtatcag
atagaaaagcatatctttaccgatcccgaccgcgatacgctgatgatgcgcgtgacgttt
accgcctttgaagcgggcatcacaccgcatttatacgttaatccccatatcgataatgcg
ggcgcgaatgatattggcagaatcgatcatcaagcccttatcgctcgtacggcgaatccc
cacagcagcgtgatgacggtgaaatcggatatcgactttgcgcaggcgaccaccggtttt
gtcggtgtatccgacggtttggccgatttagccgataacggtaagctcgatacgctgtat
caggccaccagcagcgccgaaaatccgactcaaggcaacattgcttttaccgccagttat
cccgtactccaagcgaatcaagctcttaatgtgaatttggcgattggttttggccaggat
gaggccagcagtttagccaatgccaacgccagcttaacggcggggtatgacgcagtgctg
agtcaatacaacgctggttggcacagttatttacaatcgctgcccgcgatgccagctatg
gcgcaaagcacaacagataatggcaagctgctgtataccagtgccatggtactcaaggcg
caggaagataaaacctacgcgggcgcccttatcgcttcgctttctaatccttggggcgat
accgtccctgctgtcacacccagcacgggctacaaggctgtttggccgcgcgacttttat
caatgcgccatggcatttctcgccatgggcgatacccaaacgcctaaagtcgcctttgaa
taccttaaaaaggtgcaagtgagcgataaaaccccaggctttagcggcacacccggttgg
tttttacaaaagacccatgtggacggccaaattgaatgggtgggcgtacagctcgaccaa
acggcgatgcctatcatgctcggctggaaactctggcaggcaggcgtactcagtcaagct
gaacttaaccattggtatcaagagatgttaaaagctgcggcggactttttagtcagcggc
ggcgaagtcaatcttgactggaatcacacccaaattacgccaccaaaaacccaacaagaa
cgttgggaagaacaggcaggttattcgccctccaccacggccgcagtgatcgcaggctta
gtggccgcgagtgatattgccaaggcagtaaacgacagcgatgccagtcaacgttatctc
gcgaccgctaaaacgcttaatcaacaacttgaaaaacacttagtgacgacccaaggtttg
ctcacggatagccaaggtattaaggcgccttattatctgcgattaagccccaacggtgag
ccaaacagcgccgagcaactcgccgccaataatggccgtgcgggattagatcaacgtcag
atcctcgatggcggctttttagaactggtgcgctatggcgtgcgtggcgccaccgataag
ctgattaatcaaagcctagcgctggtggataataccgagcttgaggacaatttacgcctc
aaatacaactttatggcaaaggatggcagcagcgttccaggctttagacgttacggtaac
gatggctacggtgaagacactataaccggcgcaaactacgccgaatcgggcagtaatagc
gacaaccaacgcggccgcgtctggcccttctttactggcgagcgtgggcattttgaattg
gcccttgccagcgccaagggagagctaagcggtgctcacgcacagcaaaccaagcagcaa
cttatcaatacctatgtgcaagggatggaaaccttcgccaacgcgggtctaatgctcccc
gaacaagcatgggacggtgtgggtaacgccactcgttaccaatatcaactcggccaaggc
actaactccgccaccccgctcgcctggacccatgctgaatatatcaagctggtacgttca
atgagcgacggccgagtatgggataactaccccatcgtccctgaggcgttgaaataa

DBGET integrated database retrieval system