KEGG   Shewanella sp. FDAARGOS_354: CEQ32_07425Help
Entry
CEQ32_07425       CDS       T04944                                 

Gene name
panP
Definition
(GenBank) putative pyridoxal-dependent aspartate 1-decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
shf  Shewanella sp. FDAARGOS_354
Pathway
shf00250  Alanine, aspartate and glutamate metabolism
shf00410  beta-Alanine metabolism
shf00430  Taurine and hypotaurine metabolism
shf00650  Butanoate metabolism
shf01100  Metabolic pathways
shf01110  Biosynthesis of secondary metabolites
shf01120  Microbial metabolism in diverse environments
shf02024  Quorum sensing
Module
shf_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CEQ32_07425 (panP)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CEQ32_07425 (panP)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CEQ32_07425 (panP)
   00430 Taurine and hypotaurine metabolism
    CEQ32_07425 (panP)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CEQ32_07425 (panP)
Enzymes [BR:shf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CEQ32_07425 (panP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase P53_tetramer
Motif
Other DBs
NCBI-ProteinID: ASF14844
UniProt: A0A1Z4AA61
LinkDB All DBs
Position
1639122..1640771
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQAIASEESLMRIFTVPEDAESTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPSQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYAQNDDFYRNWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGDFKGVTREGLIKALRHYGLDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTDGNNKVDVAKMREVAAELANKRIKVMAIVGVAGTTETGNIDPLRELAALASEL
NCHFHVDAAWGGASLLSNKYRHLLDGIELADSVTIDAHKQMYVPMGAGMVLFKNPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIDAHPDFELVTAPELCLLTYRYVPANVQAAMQVAIDQGDKTKLARFNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQPTVVFRVVLANPLTSHEILNQVLIEQGEIAALDNEFL
PALLAMVNE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaactccctcgccaagccatcgcatctgaagaaagcctgatgcggattttc
actgtgcccgaagatgcggaatccaccttaagcattattgagcagaagctttccgaggac
ttagccggttttttgggtgacagcattgccgcactggaaaagccgctttccgaaatcgaa
accgattttcaagcctttgaaattccaagccagccgcgttttgtctccgactacaccgac
gaaatcatgcagaatctggtggcgcattcggtgcatacggcggcgcccagttttatcggc
catatgacctcggcactgccctatttcgtgttgccactgtcgaagatgatggtggggctg
aatcaaaacttagtcaaaatcgaaacatccaaagcctttacgccgcttgagcgccaagtg
ctcggcatgatgcaccatttgatttacgctcaaaatgatgatttttatcgtaattggatg
cacagcgccaaccattccctcggcgcattttgctccggtggcactgtggctaacatcact
gccctgtggattgcccgcaaccaattactcaaggccgatggcgactttaaaggcgtgacc
cgcgaaggcttaatcaaggcgctgcgccactatggcctcgatgatttagcgattctggtc
tccgagcgcggccactactctttaggtaaggccgtcgatctgctcggtatcggtcgcgac
aatatcatcagcatcccaaccgatggcaataataaagtcgatgtagccaaaatgcgcgaa
gttgcagccgaactagcaaacaaacgcatcaaagtcatggcgatcgtgggtgtggctggc
accaccgagacgggcaatatcgacccactgcgcgaacttgccgccttagcaagtgagcta
aactgccacttccatgtggatgcggcttggggcggcgcaagcttattatccaataaatac
cgtcacttactcgatggtattgaactcgcagattcagtcaccatcgatgcccataagcaa
atgtatgtccccatgggcgcgggtatggtgttatttaaaaatcctgagtttgcccatgcc
attgcccaccatgccgaatatattctgcgccgaggctctaaggatttaggcagccaaacg
ctagaaggctcacgcccaggcatggcgatgttagtgcatgcctgtttacagattatcggc
cgcgatggttacgaaatcctgattaataacagccttgaaaaagcgcgttattttgccgaa
caaatcgacgcacaccctgactttgagctggtcaccgcgccagagctgtgcctgctcacc
tatcgttatgtgccagcgaatgtgcaggcagcgatgcaagtggcgatagaccaaggcgat
aagaccaaactcgctcgctttaatgagctgctcgatggcctgacccaatttattcaaaaa
caccaacgcgaacagggtaaatcctttgtctcccgcacccgcattcaacccgcgcgctac
tttagacaacccacagtggtgtttcgcgtcgtattagctaatcccttgactagccatgag
atccttaatcaagtgcttatcgagcaaggtgaaattgccgcattggataacgagttctta
cctgcgctattagctatggtcaatgaatag

DBGET integrated database retrieval system