KEGG   Sphingobacterium sp. 21: Sph21_2181Help
Entry
Sph21_2181        CDS       T01450                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00500  Starch and sucrose metabolism
shg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sph21_2181
Enzymes [BR:shg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Sph21_2181
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Sph21_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH EcKinase Glyco_hydro_77 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ADZ78736
UniProt: F4CCE3
LinkDB All DBs
Position
complement(2668185..2671502)
Genome map
AA seq 1105 aa AA seqDB search
MKNGQLDNQLHWYKDAIIYELHIKAFRDGNGDGVGDFEGLLQKLDYLQDLGITAIWLLPF
YPSPLRDDGYDIADYYNINPAYGNIKKFKRFLREAHKRGLKVITELVINHTSDQHPWFQR
ARRAPKGSGLRNYYVWTDDPNQYAEARIIFQDFESSNWSWDPIAQQYYWHRFFHHQPDLN
YDNPLVQKEVFDILNYWCAMGVDGFRLDAVPYLFERDGTNCENLPETHAFLKKLREHIDL
HYPGTLLLAEANMWPEDSAAYFGAGDECHMNYHFPIMPRMFMALQMEDRYPLTDIFEQTP
SIPPTCQWAIFLRNHDELTLEMVTDEERDYMYKVYVKDPVARINLGIRHRLAPLLENNRK
KIELLNALLFSLPGTPVIYYGDEIGMGDNYYLGDRDGVRTPMQWHPDRNAGFSEANPQRL
YLPLILDPEYHYESVNVELQSRNTSSLLWWMKRMISTRKKYKAFGRGDIQFVYTENAKIL
AFTRTYDNEIMLVVANLSRFSQAAELFLETYKGFAPIEILSRNRFPVIKEDLPYFFTLGP
YASQVFLLEKAHPELADEARLHLIEIDEWKELLDEPVIEQLENRILPDYIMKLRWFGGKG
KGPENFRIIDHATIGLEEGTAFLLLIEVSYHDGLPETYQLPVAFGKGQFSYRLQDNCPQS
VIAHLKVGHTEGVLYDAIYGIELQHAIIANMVGNRQIGQKNGQISFLGNKKVKKHIKENP
RPRPRVLSAEQSNTSIIYDNTFYLKIYRKVDAIINPDVEMIAYLSGTARFKHVPAYLGRI
QWEFKSGHTMVLATMQEMAVSNSDGWTYMLDRLNDFNERVLSHADPNSLLEEVKGKLLLP
LNFDEIPNNMKLLLEGNLAELVKLLGIRTAEMHLALAKPTELPEFKPEPFSLHYQRSLYS
SLQSLVRASFQSLQKNMENLSAEVQEEAKEVLLLRERVLSTMKRIYQHRIDAVKTRIHGD
YHLGQVLFTGKDFLILDFEGEPARSYSERRLKFSPLRDVAGMLRSLHYAAFGSLLLDNQI
REDDIKTLTPFIEQWYHYMSGFFMRAYLDKVNEAAFIPTRLEDLQIMMDVYLLQKAVYEL
NYEINNRPNWVLVPLRGIKSILKEV
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacggccaattagacaaccaacttcactggtacaaagatgccatcatatatgag
ttgcacatcaaagcgtttcgcgatggaaatggcgatggggtgggcgactttgaagggttg
cttcaaaaacttgattatttacaggacttaggtattaccgccatttggttactcccattc
tatccttcgccccttcgagatgatggatacgacatagccgactattataacatcaatccg
gcatacggtaacatcaaaaaatttaaacgctttcttagagaggcacataaacgcggccta
aaggtaataactgagctcgttatcaaccatacctcggatcagcatccgtggtttcaacga
gcgcgaagagctcctaaaggctccggacttcgaaattattatgtgtggaccgatgatccc
aatcagtacgccgaggcacggattatttttcaagacttcgaaagttccaattggtcgtgg
gacccaattgctcagcaatactattggcatcgattctttcatcatcaacctgatcttaat
tacgacaaccccttggtgcaaaaggaagtgttcgatattctaaattattggtgcgccatg
ggggtagatggctttcgattggacgctgtcccttacctttttgagcgagacggcactaat
tgcgaaaacttacccgaaacccatgcctttttaaagaaactacgggagcacatagaccta
cattacccaggcacccttcttttagcggaagccaatatgtggccggaggattctgccgct
tattttggagccggagacgaatgccacatgaattaccatttccccattatgccgcggatg
tttatggcattacagatggaagaccgatatcccctgaccgatatttttgaacagacgcct
tccatccctcctacctgccagtgggcaatttttctgcggaaccacgatgaacttacattg
gaaatggtaaccgacgaagagcgtgactatatgtacaaggtttatgtcaaggatcctgta
gccagaattaatttagggatcaggcaccgattagcccctttattagagaacaatcgaaag
aaaattgagttgcttaatgccttattgttttcattaccgggtactcccgtaatctattac
ggagacgaaataggcatgggcgacaattactatttgggcgaccgagacggtgttcgtacc
cctatgcaatggcatcccgatcgtaacgcaggcttttctgaagctaatccgcaacgattg
tacctcccgctcattctagaccctgaatatcactatgaatcagtcaatgttgaattacaa
tcgcgcaacacctcttccctactttggtggatgaaacgaatgatcagcactcgtaaaaag
tataaggcttttggtcgtggcgacattcaattcgtgtacacggaaaacgctaaaatttta
gcctttacaagaacatatgacaatgaaattatgctcgtagtggccaatttgtcccgcttc
tcgcaggctgcggagctatttctagagacttacaaagggtttgccccgatcgaaattcta
agtcgcaaccgcttccctgtcataaaggaagatctaccctatttcttcacattaggccct
tatgcaagtcaagtgttcttactcgaaaaagcacatccggagctggcggatgaagcaaga
ttacatttaatcgagatagacgagtggaaagagctgttagacgagcctgttatcgaacaa
ctggaaaaccgtattctaccggattacatcatgaaattacgttggtttggaggaaaaggc
aagggacctgaaaacttccgaatcattgatcacgctactattggcttggaagaaggaacc
gcctttttattgcttatcgaggtatcctatcatgatggcttaccggaaacctatcaattg
cctgtagctttcggcaaggggcaattttcctatcgtttacaagacaattgcccgcaatca
gtaatcgcccatttgaaagtaggccacacggaaggcgttctttatgatgccatttatgga
attgagttgcagcatgccatcatcgccaatatggttggtaaccgacagataggtcaaaaa
aacggacaaataagctttttgggaaacaaaaaagtaaaaaaacatatcaaggaaaatcca
aggcccaggcctcgtgtattgagtgcagagcagagcaatacttctattatttacgataat
acgttttatcttaaaatctatcgaaaggtcgacgcgatcattaatcccgacgtggaaatg
atcgcctatctttcgggaacggctcggttcaagcacgtcccggcttatttaggtagaata
caatgggaatttaaatcaggccacacgatggttttagccacgatgcaggaaatggccgta
agcaacagcgatggatggacttatatgctcgatcgcttaaacgatttcaatgaaagggta
ttgtctcacgctgaccccaattcactgctggaagaagtaaagggaaagctattacttccc
ttaaattttgatgagatacccaacaacatgaaactgctgctggaaggcaatcttgcagaa
ttggtaaagctgttaggtataagaactgccgaaatgcatctcgctttagcaaaaccaacg
gaactacccgaatttaaacctgagcccttttcgctccattaccagcgctccctatattcc
tcactccaatcactggtacgcgcaagctttcagagtcttcaaaaaaatatggaaaaccta
agtgcagaagttcaggaagaagcaaaagaagtgctgttactccgcgagagagtcctcagt
acgatgaaacgtatctatcagcatcgaatagatgctgtcaaaacccgaattcacggcgac
taccatttaggtcaggtactttttacgggcaaagattttttaatactcgactttgaaggc
gagccggctcgaagttatagtgaacggcgcttgaagttttcgcccttacgtgacgtagcc
ggtatgttgcgctccttacattatgctgccttcggcagcctgcttcttgataaccagatc
cgagaggacgacatcaaaacgctaactccatttatcgagcaatggtaccactatatgagc
ggctttttcatgcgtgcctaccttgacaaggttaatgaagcagcatttataccaacccgg
ttggaggatctacaaatcatgatggacgtatatttgctacaaaaggccgtatatgaactg
aattatgagattaacaatcgtcccaactgggtactcgttccgctccgaggcattaaatcc
attttaaaagaagtttaa

DBGET integrated database retrieval system