KEGG   Sphingobacterium sp. 21: Sph21_2578Help
Entry
Sph21_2578        CDS       T01450                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:shg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Sph21_2578
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:shg03400]
    Sph21_2578
Enzymes [BR:shg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Sph21_2578
DNA repair and recombination proteins [BR:shg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Sph21_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C TGT_C1
Motif
Other DBs
NCBI-ProteinID: ADZ79129
UniProt: F4CFH6
LinkDB All DBs
Position
complement(3177547..3180264)
Genome map
AA seq 905 aa AA seqDB search
MPLDQYRNKRDFKKTSEPKSGKSPNRKQLTFVVQKHKASRLHYDFRLEMDGVLKSWAVPK
GPSTDPQNKRLAMMVEDHPMDYRQFEGIIPKGQYGGGTVIVWDEGTYEPIEGLKSKKAQE
KHLLEQLHKGSLKIRLHGHKLKGEYALVKTQGMGENGWLLIKHKDEFASKSDITKKDKSV
LSDKALEEIEKSSNKVWQNGREKTVEKSRKTTQAKKSKNADEHLADDVNEAGEPQKMDVP
SLLKKAPESTIPKSIKPMKATLIDEPFDDPDWLYEVKWDGYRAIAKVSKTDVKLISRNNI
PFDKYYPLVDLLKGWRINAVIDGEIVVLDEKGLSDFGALQNWRSEADGNLVYYVFDILWY
EGKNLMGLPLVERQAILQDILPTDDDRIRQSKVFAARGIDFFDAAEQVGLEGIIAKKADS
KYTSDLRSKEWLKIKVQRRQEVVIAGFTRNEGTSKAFSALVMGVYDGKKLRYAGKVGTGF
SDSKQKEMMKLFKPLITDRSPFDVEPDVDKPSRFRPQRLGAKPTWLKPELVCEVNYAEVT
SEGIFRQASFKGMREDKEADDVVLEKAADTESTVAEVEEEDKGTKHAIKPAKTERRTLLN
PREETQTRKVNGKELKFTHLSKVYWPDDGITKRDMFNYYYRIAEFILPYLKDRPMSLNRF
PNGIKGPSFYQKDVKGKVPEWVSKTYPYTTSEGEHKEYLVGDDEATLLWMASLGCIEMNP
WFSRVQSPDNPDYCVIDLDPDKNTFEQVIEAAQEVRKVLDALGVSSYPKTSGSTGIHIYI
PLGAKYSYEQSQLFAKVIVSLVHEQLPDFTSLKRKVSDRKGKMYLDFLQNRPGATIAGPY
SLRPKPGATVSMPLAWDEVKRGLKMSDFTIHNAYDRLKETGDLFKGVLGKGIELNKIIKK
AQNDL
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttgatcaataccgtaacaaacgagattttaaaaagaccagtgaaccgaagtca
ggtaagagtccgaaccggaaacaactcacttttgtggtgcaaaaacacaaagcatcgcga
ttacattacgactttcgcttagaaatggatggggtgctgaaaagctgggctgtgcctaaa
ggcccatccactgatccgcagaacaagcgtttggcgatgatggtggaagatcatcccatg
gactatcggcagtttgaggggattatccctaaaggacaatatggcggcggtacggtaatt
gtttgggacgaaggcacctatgaaccaatagaaggactgaagagtaagaaggcacaagaa
aaacatttattggagcagcttcataaagggtcactcaaaatccggctacatggacataaa
ctaaaaggcgaatatgcgctggtaaaaacacaagggatgggtgaaaacggctggctcctt
atcaaacacaaagacgaatttgccagtaaatctgatatcactaaaaaagacaagtcggtg
ctttctgacaaagcattggaagagattgaaaaaagcagcaataaggtatggcaaaacggc
cgtgagaaaaccgttgaaaagtctagaaagaccacacaagcaaaaaaaagcaaaaatgct
gatgaacacttggcggatgatgtaaatgaagccggagagccgcagaagatggatgtaccc
agcttgctaaaaaaagcaccggaatccactattccgaaatcaatcaaaccgatgaaggct
acccttattgacgaaccttttgatgatccggattggctatacgaagtaaaatgggatggt
tatcgtgccattgccaaggtcagtaagacagatgttaaactaatttctcggaataatatt
cctttcgataaatactatccgcttgtcgaccttttgaaaggatggcgtatcaatgccgta
attgatggagaaattgttgtgctagatgaaaaagggctgtccgactttggggccttacag
aattggcgaagcgaagccgatggcaacttggtttattacgtttttgacattttatggtat
gagggcaaaaacctgatgggattgccattggtagaacggcaggcaatccttcaggacata
ttacctactgatgatgaccgtatccgccaaagtaaggttttcgccgcaagggggatcgac
ttttttgacgcggcagagcaggtcgggcttgaaggtattatagcaaaaaaagctgatagt
aagtacacctctgaccttcgatcgaaagagtggcttaagatcaaagtgcaacggcgacaa
gaagtagtgatcgctgggtttacgcgtaatgagggaacgtccaaagcgttcagtgccctc
gtcatgggggtgtatgacggaaagaaacttcgatatgcgggtaaagtgggcaccggtttt
tcggacagcaagcagaaggaaatgatgaagctattcaaaccgctgatcaccgacagaagt
cccttcgatgtagaacctgacgtggacaagccatcccgttttcgtccacaacgactcggc
gcaaaacctacatggctgaaaccggaactggtatgcgaagtgaattacgccgaagttacc
agcgaaggaattttccggcaggcatctttcaaaggtatgcgggaggacaaagaagccgat
gatgtcgtattggagaaagcggctgacacagaatccaccgtggccgaggtggaagaagaa
gacaaggggactaaacatgcaatcaagcccgctaaaaccgaaaggcgtaccctcttgaac
ccacgtgaagagacgcaaacacgtaaagttaatggtaaagaattgaaatttacgcatctc
agcaaggtctattggccggatgacggcattaccaaacgagacatgttcaactattattac
agaatagccgaatttatcttaccctacttgaaagatcgtccgatgtctctgaaccgcttc
ccaaatggcattaaaggtccaagcttttatcaaaaagatgtgaagggaaaagtgccggaa
tgggtaagcaaaacttacccatacaccaccagcgagggtgaacataaagaatacctggtt
ggcgacgatgaagcaaccttgctatggatggcgtcattaggctgtattgagatgaatcct
tggtttagcagagtgcagtcgcccgataatccggattattgcgtgatcgatctggatcct
gataaaaacaccttcgagcaggtcatcgaagccgctcaggaagtgaggaaggtattggac
gctttaggcgtatcgagctatcctaaaacatcagggtccaccggtattcatatttacatc
ccattgggagcgaaatactcttatgagcaatcgcagctttttgcaaaggtcatcgtcagt
ctggtacacgagcaactacccgatttcacatccttaaaacgaaaagtaagtgatcgaaaa
ggaaagatgtatctagacttcttgcaaaaccggcccggagctactatagctggcccctac
tccctacgaccaaagccgggagcaaccgtctcgatgccacttgcctgggacgaagtgaaa
cgtggtttaaaaatgagcgactttactattcacaatgcttatgatcggttgaaagagact
ggtgatctcttcaaaggagtacttggaaagggaatagaacttaataaaatcataaaaaag
gcgcagaacgatttgtaa

DBGET integrated database retrieval system