KEGG   Sphingobacterium sp. 21: Sph21_2909Help
Entry
Sph21_2909        CDS       T01450                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00564  Glycerophospholipid metabolism
shg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sph21_2909
Enzymes [BR:shg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Sph21_2909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 HI0933_like Lycopene_cycl NAD_binding_8 Pyr_redox_3 GIDA 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ADZ79456
UniProt: F4C1V6
LinkDB All DBs
Position
complement(3619117..3620715)
Genome map
AA seq 532 aa AA seqDB search
MQENTILQHTFSRNVSLGQLSQNSLWDIAIIGGGATGLGIAVDAASRGYKTLLVEQADFA
KGTSSRSTKLVHGGVRYLAQGDIKLVYGALRERGIIFKNAPHLAHAQSFVIPCYTWFAQL
KFLIGLKIYDWMAGKYRIGRSSLLSKKEVTTRIQGVKVKHLKGGIEYYDGQFDDARLAIN
LAQTASQFGATLLNYAKVVSLNKDDKGKTNGFTVLDQESGEAYKVKAKVVINATGVFVDE
ILTLEQPKHQALVRPSQGVHIVIERSFLQGKSALMIPETSDGRVLFGVPWHNKLVLGTTD
TPLNQHSLEPRALEQEIDFILKTAGEYLDNRPTRKDALSIFAGLRPLAAPKDGKESTKEI
SRDHKLLVSDSGLITITGGKWTTYRKMAEDTVNQAIKTANIAFQPCKTVDIRIHGADISN
HEQGHWTVYGSDAEKIKSLISEENGLGEKLHVNYPHVKAEVVWAIREEMARTIEDVLARR
IRMLFLDAKAAIEMAPTVAQIMASELGKDANWIKEQLMEFDTLAKGYLIGLQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaacaccattctccaacacacattcagccgtaacgttagtttagggcagcta
agtcaaaacagtctttgggatatcgccatcattggaggtggagcaactggccttggcata
gcagtcgatgcggctagccgaggttataagacgctactggtagaacaggcagacttcgct
aaaggcacttccagtcgaagcaccaagttggttcatgggggtgtacgatatcttgcacaa
ggtgatatcaagcttgtttacggtgcgctccgggaaaggggaattattttcaaaaatgcg
cctcatttggcacatgcgcaaagtttcgtcataccatgctacacctggtttgcgcaactg
aaatttttaataggactcaagatttacgattggatggcaggcaaatatcgcatcgggagg
tcgtcccttctgtccaaaaaagaagttaccactcgtatacaaggcgtaaaagtcaagcac
ctgaaaggtggtatagaatattacgatggacaattcgacgatgctcgtttagcgatcaat
cttgcacaaacggcttcacagtttggagccacgctgctgaattatgccaaagtagtcagc
ttaaataaagacgacaaaggaaagacaaatggttttacggttctcgatcaagaaagtggg
gaagcctataaagtaaaagctaaggtggttatcaatgccaccggtgtttttgtagacgaa
atcttaacgcttgaacagccaaaacatcaagcgttggttaggcccagccaaggtgttcat
attgtaatagaacgttcttttcttcagggaaagagcgccttaatgattcctgaaaccagt
gatggcagggttctttttggcgtcccttggcataacaaactagtactgggtacaacggat
accccacttaatcaacacagcctagaaccaagagcacttgaacaagaaatagattttatc
ttaaagactgcgggggaatatcttgacaacaggccaaccagaaaggatgcattaagtata
tttgccggcttaagaccattggcggctcctaaagacggcaaagaaagcacaaaggaaatc
tcacgtgaccataaattgctagtcagcgattccggactaattaccattacaggcggtaag
tggaccacttatcgaaaaatggcggaagacaccgtaaatcaagccattaaaaccgccaat
atcgcttttcagccatgtaaaacagtcgacatccgaattcatggtgcagacataagcaat
cacgaacaaggtcattggaccgtttatggctcagatgccgaaaaaatcaaaagcctgata
tcagaagaaaatggattgggagaaaagctgcatgtcaactatccgcatgttaaagcagaa
gtagtatgggctatccgcgaagaaatggcacgtacgattgaagatgtgctggctaggcga
atacgcatgctttttctcgatgcaaaagctgctatagaaatggccccaaccgttgcccaa
ataatggccagtgagctagggaaagatgcaaattggataaaggaacaacttatggaattt
gacacgcttgccaaaggttaccttattggtttacaataa

DBGET integrated database retrieval system