KEGG   Sphingobacterium sp. 21: Sph21_3165Help
Entry
Sph21_3165        CDS       T01450                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00620  Pyruvate metabolism
shg00680  Methane metabolism
shg01100  Metabolic pathways
shg01120  Microbial metabolism in diverse environments
shg01200  Carbon metabolism
Module
shg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:shg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sph21_3165
  09102 Energy metabolism
   00680 Methane metabolism
    Sph21_3165
Enzymes [BR:shg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sph21_3165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADZ79708
UniProt: F4C258
LinkDB All DBs
Position
3922254..3924839
Genome map
AA seq 861 aa AA seqDB search
MKLSQKEAVYENEVLTRFELYNSLFLTLPFYQVKHTGTLLPFFSTHIEKGVNDKMDPEAI
IESFFGQYEQYIHKADRFDLLFRIIQYIERQVVLFDAIEDAAFSKTGRADDAGSLESLFK
RAENNNVLRDKIVNRLKDFSLRLVLTAHPTQFYPGEVLGIITDLTGALKKNDINDIHLLL
QQLGKTPFLQKNKPTPVDEARSLAWFLEHVFYPVVSDIQCMVDNDFDANGSIREAEKQIV
ELGFWPGGDRDGNPNVTTESTKEVSALLRTILFRCYYRDFRVMKRRITFRGVEKYMAALQ
EIFYENSFNPQENQTNVKDAIIFNLSEVKRVLTDYHDGLFVNLVDDLLRKVKIFGTYFSS
LDIRQDSSILRKTYQYLYKAHPEETGIDADFETLEEADKIMSARFREADLPTDNIKDPLI
LDMVETIRFVQKIQQSGGPKACHRFIISNCQQASDILSLMELFLWNGWKKETLSIDFVPL
FETVDDLKRAANVMEILYNNKAYQSHLKYRENKQTIMLGFSDSTKDGGYLMANWSIYKAK
MELTAMARKYDVDLTFFDGRGGPPARGGGKTQRFYASMGDEIANDHIQLTIQGQTISSQY
GSFDTAHYNIEQLLNAGITSGIKTKPGDTLSQEKKMLIDRMAGASYNKFMELRKHPLFLK
YLEELSPLKFLSSLNISSRPVKRNSNSELRLEDLRAISFVTAWSQLKQSVPGCYGVGTAL
KNADDSGEWDKVQELYNTSGMFKTIIDNSIMSMTKSNFNITAYLKDDEKFGTFWNMLREE
FELTKQYFLKLTGTMMLMERYPVERKSIATREKIVLPLVIIQHYAIKKMHNLSTDDPNYE
IYGKLLTRTVYGIVNAGRNLV
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaagtcagaaagaagctgtttatgagaatgaggtcttgacacgctttgaactc
tataacagtctttttttaacattaccattttatcaagtcaagcataccgggaccctattg
cctttcttttcaacacatatcgaaaagggagtaaatgataaaatggatcccgaagcaata
attgaaagtttttttggacaatacgaacaatatattcacaaggccgatcgcttcgatttg
cttttccggatcatccaatatatcgaaagacaggtcgttttatttgatgcgatagaagat
gccgctttctcgaagaccggtagggccgatgatgccggatcattggaatctttatttaaa
cgtgctgaaaataataacgtattacgtgataagatcgttaatcggttgaaagatttttcg
ctgcgattggttcttaccgcccatcctacacagttctatccgggcgaagtgttgggtatt
atcaccgacttaacaggggctctaaaaaagaatgacattaacgatattcatttattgtta
cagcagttaggcaagacaccgttcctacagaaaaataagccaacacccgttgacgaagcc
aggagcttagcctggtttttggagcatgtgttttacccggttgtttcggatatacaatgt
atggtggataatgactttgatgccaatggttctattagggaagcggaaaaacaaatcgtt
gagttgggcttctggccggggggggatcgcgatggaaatcctaatgtgactacagaaagt
acaaaagaggtttctgctttgttgagaaccatcttgttcaggtgttactaccgggatttt
agagtgatgaaacgccgtattactttcagaggagtggaaaagtatatggcagctttgcag
gaaattttctacgagaatagctttaacccacaggaaaatcaaacgaatgtaaaagacgct
atcatcttcaatttaagtgaagtaaaacgagtgcttaccgactatcacgacggtcttttt
gtgaaccttgtggacgatcttttgcggaaggttaaaattttcgggacctacttctcgagc
ttggatattcgccaggatagcagcatcctccgcaaaacatatcaatacctctacaaagct
catccggaagagacaggaattgatgcagattttgaaacgttggaggaggcagacaagatt
atgtccgctcgcttccgtgaggctgatttaccaacagacaatattaaggatcctttaatt
ctggatatggtagaaacgattcgttttgttcaaaaaatccagcagtcgggaggaccgaag
gcctgccatcgatttattatcagtaattgtcaacaagcgtcagatattctgtctcttatg
gaacttttcctatggaacggttggaagaaagagacgctttcaattgattttgtaccattg
tttgagacggtagatgatctgaagcgtgcggctaatgtgatggaaatcctctataacaat
aaggcttatcaatcccatcttaaataccgtgagaataagcaaacaattatgctcgggttt
tcagatagcacaaaagatggtggatacctaatggccaattggtctatttacaaagcaaaa
atggagcttactgcgatggcgcgtaaatacgatgtcgatttaaccttctttgatggacgg
ggtgggcctccggctagaggaggagggaaaacccaacggttttatgcttctatgggtgat
gaaatagcgaatgatcatatacaattaacgattcaggggcaaacgataagtagtcagtat
ggctcttttgataccgcacattacaatattgagcaattgttgaatgccggtataacttca
ggaataaaaaccaaacctggcgataccctcagtcaggagaagaaaatgttgattgatcgt
atggctggagctagctataataaatttatggagctaaggaaacaccccttattcctaaaa
tatctggaagaacttagtccattgaagttcctgtcatctcttaacatcagcagtagaccg
gtaaaaagaaattcaaattctgaattacgattggaggacctacgggcaatcagttttgta
accgcttggagccaactgaagcaaagtgtccctggttgttacggcgtgggaacggcgctt
aaaaatgcagacgattcgggcgagtgggataaagtgcaagaactttataatacttccggt
atgttcaaaacaatcattgataatagtattatgtctatgacgaaatcaaattttaatatc
actgcctatttaaaagacgacgaaaagtttgggacattttggaatatgcttcgcgaagag
tttgagttaactaagcaatactttttaaaattaacgggtaccatgatgcttatggaacga
tatcccgtggaaaggaaatcgattgctacgagagagaaaatcgttctacctcttgtcatt
attcaacattatgcgattaaaaaaatgcataatttgagtacggatgatccgaattatgag
atttatggtaaattactcacccgcacggtatatggtattgtcaacgccggaaggaatttg
gtatga

DBGET integrated database retrieval system