KEGG   Sphingobacterium sp. 21: Sph21_5174Help
Entry
Sph21_5174        CDS       T01450                                 

Definition
(GenBank) glycosyl hydrolase BNR repeat-containing protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00511  Other glycan degradation
shg00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:shg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Sph21_5174
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sph21_5174
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:shg02042]
    Sph21_5174
Enzymes [BR:shg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Sph21_5174
Bacterial toxins [BR:shg02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Sph21_5174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_assoc_N BNR_2 BNR_3 BNR Sortilin-Vps10 CHB_HEX_C DUF4185
Motif
Other DBs
NCBI-ProteinID: ADZ81663
UniProt: F4C4T2
LinkDB All DBs
Position
6112251..6113912
Genome map
AA seq 553 aa AA seqDB search
MSIYKISLLIYVFGIFFHLSMAKPVIQIEQTQFQVPILIGKPVNPVLRIKITIEGTKPHQ
LKALSLQTQGTTAIQDLNTVEVYYTGKDTLLNKMSTALKLFGKKANPKANITLEGDTELN
PGIHYLWVTCRLTDQANLLHKIAFQLEDVHFNESTDVRITDRPIMEQRIGIAIHQRMENG
IHTARIPGLAVTPKGTLLAIFDARRESSRDLQGDIDIGLRRSTNGGQTWEPLTIAMDMGK
WGGLPEKFNGVSDACILVDKNSNTIYIAALWMHGIIDKDGQWVKGLKENSDHWNHQWKNK
GSQPGFGIKQTSQFMLVKSTDDGKTWSKPLNITKMCKKKDWWLFAPAPGNGIVLNDGTLV
FPTQGRDSLGTPFSTITYSKDSGKTWQTAKRALNEVATTECAVVQLADRSLMLNMRANKN
KGEIGSNNGRAVCVTRDMGKTWTQHPSAFHALPEPVCMASLYKHSFMDAGKQRHLLLFSN
PNSKTDRDHLTIKVSTNDGQTWPQKYWVLLDEWKGRGYSCIAAVDEQHIGILYESSQADM
VFQKIAVSEWPEK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttacaaaatatcattactaatttatgtgtttggcatttttttccatctgtct
atggctaaaccggttatccaaattgaacagacacaatttcaagttccaattttaattgga
aaaccggtaaacccggtacttcggatcaaaattaccatagagggcacaaaaccgcatcag
cttaaagctctctccttgcaaacacaaggcacaacagctattcaagatttaaatactgta
gaggtatactatacaggcaaagacacgctgttgaacaaaatgtcgacagcactgaagctc
ttcggtaaaaaagccaatcctaaagccaatataaccctagagggtgatacggaactaaat
ccgggaatacattatctttgggtcacctgtcgtcttactgatcaagccaatttgctacat
aaaatagctttccaattagaagatgtacactttaatgaatccaccgatgtgagaataacc
gaccgtccaataatggaacaacgcatcggcattgccatacatcagcgcatggaaaatggc
atacataccgcacgcattcctggtttggctgtcactcccaaagggactttgcttgccatt
tttgatgcccgcagagaaagctctcgcgacttacaaggagatatagatatcggtctccgt
cgaagtaccaatggtggacaaacctgggagcctctaacaattgcaatggatatgggcaaa
tggggaggcttaccggaaaaatttaatggtgtatcagatgcatgcatacttgttgacaaa
aactcaaataccatttacattgcagcattgtggatgcacggtattatcgacaaagatgga
cagtgggtaaaaggtttaaaggaaaacagcgaccattggaaccatcaatggaaaaacaag
ggctctcaacctggattcgggataaagcaaacatcacaatttatgctggttaaaagtacc
gatgacggtaaaacttggagcaaaccgctgaacattacaaaaatgtgtaaaaagaaagat
tggtggctctttgctccggcacctggtaatggcattgtattgaacgatggtacactggtt
tttcccactcagggtcgtgattctttaggcacgccattttcaaccatcacatatagtaag
gatagcggaaaaacatggcaaaccgccaaaagagccttaaatgaggtagcgacgactgaa
tgcgccgttgtacaacttgcagaccgatcgcttatgctcaatatgcgggctaataaaaac
aaaggcgagataggctccaacaacggccgggccgtttgtgtaacccgtgatatgggcaag
acatggactcaacacccaagcgcttttcatgcactgcccgaaccggtttgtatggcgagc
ttgtataaacattcgtttatggatgcaggaaaacaacggcatcttttactgttttccaat
ccaaactcaaaaacggatagagatcacttaacgattaaagttagcactaatgacggccaa
acatggccacaaaaatactgggtgcttttggatgaatggaaaggcagaggatattcgtgt
attgccgctgtggatgaacaacatattggtattttatatgaaagtagtcaagccgatatg
gtctttcaaaaaatagctgtaagcgaatggcctgaaaaatag

DBGET integrated database retrieval system