KEGG   Staphylococcus haemolyticus Sh29/312/L2: ShL2_00804Help
Entry
ShL2_00804        CDS       T03837                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
shh  Staphylococcus haemolyticus Sh29/312/L2
Pathway
shh00010  Glycolysis / Gluconeogenesis
shh00071  Fatty acid degradation
shh00280  Valine, leucine and isoleucine degradation
shh00310  Lysine degradation
shh00330  Arginine and proline metabolism
shh00340  Histidine metabolism
shh00380  Tryptophan metabolism
shh00410  beta-Alanine metabolism
shh00561  Glycerolipid metabolism
shh00620  Pyruvate metabolism
shh00625  Chloroalkane and chloroalkene degradation
shh01100  Metabolic pathways
shh01110  Biosynthesis of secondary metabolites
shh01120  Microbial metabolism in diverse environments
shh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ShL2_00804 (aldA)
   00053 Ascorbate and aldarate metabolism
    ShL2_00804 (aldA)
   00620 Pyruvate metabolism
    ShL2_00804 (aldA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ShL2_00804 (aldA)
   00561 Glycerolipid metabolism
    ShL2_00804 (aldA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ShL2_00804 (aldA)
   00310 Lysine degradation
    ShL2_00804 (aldA)
   00330 Arginine and proline metabolism
    ShL2_00804 (aldA)
   00340 Histidine metabolism
    ShL2_00804 (aldA)
   00380 Tryptophan metabolism
    ShL2_00804 (aldA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ShL2_00804 (aldA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ShL2_00804 (aldA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ShL2_00804 (aldA)
Enzymes [BR:shh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ShL2_00804 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra SIMPL DUF2884
Motif
Other DBs
NCBI-ProteinID: AKC75670
UniProt: A0A2S6DPE1
LinkDB All DBs
Position
841737..843164
Genome map
AA seq 475 aa AA seqDB search
MRNYTQQYINGEWIDSDSNETIEVINPATEEVIGKVAKGNSNDVEKAVEAANNVYLEFRH
SSVKERKELLDKIVEEYKNRKQDIIEAITDELGAPLTLSENVHYQMGLNHFEEASRALDS
FEFEERRGDALVTKEAIGVSGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGEGVGNPLSEHPKVRMMSFTGSGRTGSKIMEKASKDFK
KVSLELGGKSPYIVLDDVDVKEAAKATTGKVVNNTGQVCTAGTRILIPESKKEDFLTALK
EEFSKVKVGDPREEGTQVGPIISKKQFDTVQSYIDKGIEEGAELFYGGPGKPEGLNTGYF
ARPTIFINVDNDMTIAQEEIFGPVASVITYNNLDEAIKIANDTKYGLAGYVIGKDKETLQ
KVARSIEAGRIEINEAGNQPDLPFGGYKQSGIGREWGDYGIEEFLEVKSIAGYFS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaattatactcaacaatatataaatggcgaatggattgatagcgatagtaatgaa
acgattgaagtaatcaatccagcaactgaagaagttattggtaaagtagctaaaggcaat
tctaatgatgtggaaaaagcagtagaagctgcaaataacgtttatttagaatttcgtcat
agctcagtgaaagaaagaaaagaactattagataaaattgtagaagaatataaaaataga
aaacaagatattatagaagccataacggatgaattaggtgcacctttaacattatctgag
aatgtccactaccaaatgggactaaatcattttgaagaggcaagtagagcactagattct
ttcgaatttgaagaaagacgtggagatgcattagttactaaagaggcaattggtgtttca
ggattagtaacaccttggaatttcccaactaatcaaacttcattgaaattggcagccgca
tttgcagcaggtagtcctgtagttctaaaaccttcagaagaaacaccatttgctgcagtt
attttagctgaaatatttgataaagtaggcgtaccaaaaggtgtatttaatcttgttaat
ggtgacggcgaaggtgtaggtaatccactaagtgaacatccaaaagttagaatgatgtca
tttactggttcaggacgcacgggttcaaaaataatggaaaaagcttctaaagatttcaaa
aaagtatcacttgaattaggtggtaaatcaccttatatcgtattagatgatgttgatgtt
aaagaagcagcgaaagcaactactggcaaagtagttaataacacaggtcaagtatgtact
gcaggtactcgtattttaattcctgaaagcaaaaaagaagacttcttaactgcacttaaa
gaagaatttagtaaagttaaagttggagatccacgagaagaaggtactcaagttggaccg
attattagtaagaaacaatttgatacagtccaatcatatattgataaaggtattgaagaa
ggtgcagagttattttacggtggtcctggtaaacctgaaggattaaatactggttatttc
gcgagaccaactatttttatcaatgtagacaatgacatgacaattgctcaagaagaaatc
tttggaccagttgcttctgtaatcacatataataatttagatgaagcaatcaaaattgct
aatgatactaaatatggattagcaggatatgtaataggtaaagataaagaaacacttcaa
aaagtagctcgttcaattgaagcaggtagaattgaaatcaatgaagctggcaaccaacca
gatttaccatttggtggatataaacaatctggaattggtcgtgagtggggcgattatggt
atagaagaattcttagaagtgaaatcaattgctggttatttcagttaa

DBGET integrated database retrieval system