KEGG   Staphylococcus haemolyticus Sh29/312/L2: ShL2_01404Help
Entry
ShL2_01404        CDS       T03837                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC superfamily ATP binding cassette transporter, ABC protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
shh  Staphylococcus haemolyticus Sh29/312/L2
Pathway
shh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:shh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ShL2_01404 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shh02000]
    ShL2_01404 (pstB)
Enzymes [BR:shh01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     ShL2_01404 (pstB)
Transporters [BR:shh02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    ShL2_01404 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N Rad17 RsgA_GTPase AAA_15 AAA_22 AAA_23 RNA_helicase AAA_29 AAA_10 AAA_18 AAA_30 PRK AAA_28 PhoH AAA_19 Viral_helicase1 AAA_16 AAA_24 Adeno_IVa2 AAA_14 ATP_bind_1 AAA_33
Motif
Other DBs
NCBI-ProteinID: AKC76265
UniProt: A0A2A1KEE1
LinkDB All DBs
Position
1487289..1488164
Genome map
AA seq 291 aa AA seqDB search
MANTNVKEKELAKHTDQSQESISTVVSSNEVKHNKESDSNKKVVYSTQNLDLWYGDTHAL
QNINLDILENNVTAIIGPSGCGKSTYIKTLNRMVELVPSVKTAGKILYRDQNIFDENYSK
EKLRTNVGMVFQQPNPFPKSIYDNITYGPKTHGIKDKKLLDEIVEKSLRGAAIWDELKDR
LHTNAYGLSGGQQQRVCIARCLAIEPDVILMDEPTSALDPISTLRVEELVQELKENYSII
MVTHNMQQAARVSDKTAFFLNGYVNEYDDTDKIFSNPSDKQTEDYISGRFG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatacaaatgttaaagaaaaagagttagcaaaacatactgatcaatctcaagaa
tcaatttcaacagtagtttcatcaaatgaagttaagcacaataaagaatcagatagtaat
aaaaaagtagtttattcaacacaaaacttagatttatggtacggagatacacatgcgcta
caaaacattaatttagatattttagaaaataatgttactgctattattggaccatctggt
tgtggtaaatcaacttatattaaaacattaaaccgtatggtagaattagtaccttcagta
aaaactgctggtaaaattttataccgtgaccaaaatattttcgatgaaaactattctaaa
gaaaaattaagaacaaatgtaggtatggtattccaacaaccaaacccattcccaaaatca
atttacgataatatcacttatggtcctaaaacacacggtattaaagataaaaaattatta
gatgaaatcgtagaaaaatcattacgtggcgctgcaatttgggatgaattaaaagataga
ttacacacaaacgcatacggtttatctggtgggcaacaacaacgtgtttgtattgctaga
tgtttagctattgaaccagatgttattttaatggacgaacctacatcagcattggaccca
atctctacattaagagttgaagaacttgttcaggaattaaaagaaaattactctattatt
atggttacacacaacatgcaacaagctgcacgtgtatctgataaaactgcattcttcctt
aatggttatgttaacgaatacgacgacactgataaaatcttctctaatccttctgataaa
caaacagaagactacatctcaggacgttttggttaa

DBGET integrated database retrieval system