KEGG   Staphylococcus haemolyticus Sh29/312/L2: ShL2_02368Help
Entry
ShL2_02368        CDS       T03837                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
shh  Staphylococcus haemolyticus Sh29/312/L2
Brite
KEGG Orthology (KO) [BR:shh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ShL2_02368 (ahpF)
Enzymes [BR:shh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ShL2_02368 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 Thi4 AlaDh_PNT_C FAD_oxidored FAD_binding_3 NAD_binding_8 K_oxygenase DUF2190 DAO Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AKC77219
UniProt: A0A2A1K608
LinkDB All DBs
Position
2470289..2471812
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLQQLLGLMEGDVEFRASIGSDDKSKELKELLDEIAEMSEHITIVEKELKRT
PSFSVSKPDEEAGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKGLEGKYNFE
TYVSLTCQKCPDVVQALNLMSVVNPNITHTMIDGSVFREESEDIMAVPAVFLDGEEFGNG
RMTISDILTKLGSTQDASEFEGKDPYDVLIIGGGPASGSAAIYTARKGLRTGIIADRIGG
QVNDTAGIENFITVKETTGSQFSANLAAHIEEYDIDTMTGIRATNIEKTDQAIRVTLENN
AVLETKTAIISTGASWRKLNIPGEDRLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVKHVTLFEYSSELKADTVLQDRLRSLSNVDIHTNARTAEVLGEDHVTGISYED
LNSGEMKELSLDGIFVQIGLVPNTSWIGDAVELNNRGEVVIDRNNNTNVPGIFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaaacaacaattacaacaacttttaggactaatggaaggcgat
gtagaattcagagctagtatcggttctgacgacaaatctaaagaacttaaagaactttta
gatgaaatcgctgaaatgtctgagcatataacaatcgtagaaaaagaattaaaacgtaca
ccaagcttctcagtcagcaaacctgatgaagaagctggcgtaacgtttgccggaattcca
ttaggtcatgaatttaattcacttgtattagcaattttacaagtaagtggtcgtgcacct
aaagagaaacaatcaattattgatcaaattaaaggtttagaaggtaaatacaactttgaa
acctacgttagtttgacatgtcaaaaatgtcctgacgttgttcaagcattaaatctaatg
agcgttgttaaccctaatatcactcatacaatgattgatggttctgtattccgtgaagaa
tcagaagatatcatggctgtgccagctgtattcttagatggtgaagaattcggcaatgga
cgtatgactatttcagatatcttaactaaattaggtagtacccaagatgcttctgaattc
gaaggtaaagatccatacgatgttttaatcatcggtggtggtccagctagtggtagtgcc
gcaatttatacggctcgtaaaggattacgtacaggtattattgctgaccgtattggtggt
caagttaatgatactgctggcatcgaaaactttatcactgtaaaagaaacaacaggttct
caattctcagctaatttagctgctcatattgaagaatatgatattgatacaatgacaggc
atccgtgctactaatatcgagaagacagaccaagctattcgtgtaacacttgaaaataat
gcagttttagaaactaagaccgctattatttcaacaggtgcaagctggcgtaaacttaac
attcctggtgaagatcgcttaatcaataaaggtgttgctttctgccctcactgtgatggt
cctttatttgaaaacaaagacgttgcagttatcggcggaggaaactctggtgttgaagct
gctatcgacttagcaggaattgttaaacatgttactttattcgaatattcatcagaactt
aaagcagacactgtattacaagatcgtttacgttcactatcaaacgtagatatccacact
aatgcaagaactgctgaagtattaggtgaagatcatgtaactggtatcagctatgaagat
ttaaattctggcgaaatgaaagaattaagtttagatggtatcttcgttcaaatcggacta
gttccaaacacaagttggattggtgatgcagttgaactaaataaccgtggcgaagttgtt
attgaccgtaataacaacacaaacgttccaggtatatttgctgctggtgacgttaccgat
cagaaaaataaacaaattattatttctatgggtgcaggtgccaatgcggcattaaatgca
tttgattatatcattagaaactaa

DBGET integrated database retrieval system