KEGG   Slackia heliotrinireducens: Shel_14560Help
Entry
Shel_14560        CDS       T00981                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
Organism
shi  Slackia heliotrinireducens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox FAD_binding_3 Shikimate_DH ADH_N_2 ApbA F420_oxidored 2-Hacid_dh_C Rossmann-like TrkA_N FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACV22476
UniProt: C7N6E1
LinkDB All DBs
Position
complement(1670066..1671124)
Genome map
AA seq 352 aa AA seqDB search
MFAAQLQDTKTMEYLELPTPEPGAGQVQVRVHFTGICGSDVPRFHKGAVHNFPLVLGHEF
SGEITAVGQGVDASLVGTRVSGIPLEPCGECEDCKNGNFSLCGHYGFVGSRSQGSMAEYV
VLPVENVFPLGEKVTDMEGALYEPATVALHGIELANFREGASAIVIGAGTIGILLGQALS
GYGAGVVVVSNHSQVRLDAAKAAGLENLVNTSEEGWLETAKAFNGGKGFDYVFDTAGTPK
TIIDAMAVAGSKGTVVFVGTPKDDVAFTIREWEMLNRKELTLIGSWMSYSAPWPGVEWVN
VDDFFNRGIMRVVPEMIDGVYKLQETATAFDRFVGTEKVRGKILIDSWKEVN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccgctcagctgcaagacacgaagacaatggaatacctggaactgccgacgcct
gagccgggtgccggccaggtgcaggtgcgcgtgcacttcacgggcatctgcggatcggac
gtgccgcgcttccataaaggcgctgtccataacttcccgctggttttaggccacgagttc
tccggcgaaatcaccgcggtgggccagggcgtcgacgcttctctggtcggcacccgcgtt
tcgggcattcctctggagccctgcggcgaatgcgaggactgcaagaacggaaacttctcc
ttgtgcggccattacggcttcgtcggctcccgttctcagggcagcatggccgaatacgtg
gtcctgcctgtcgagaacgtctttccgctgggtgagaaagtgaccgacatggaaggcgcg
ctctacgagccggccacggttgccctccacggcatcgagctggcgaatttccgtgaaggc
gcctcggctatcgtcatcggcgccggcaccatcggcattctgctgggacaggccctgtcc
ggttacggcgcaggtgttgtggtggtttcgaaccactcccaggtgcgactcgacgctgcg
aaggcggcagggctggaaaacctggtcaacacttctgaagagggctggctggaaaccgcc
aaggctttcaacggcggcaagggctttgattacgtgttcgatactgccggcacgcccaag
accatcatcgatgcgatggccgtcgcgggcagcaagggcacggtggtgttcgtcggcacg
ccaaaagacgatgtggccttcaccatccgcgaatgggagatgctcaatcgcaaggaactt
accctgatcggttcgtggatgtcctattccgcaccgtggcccggtgtcgaatgggtaaac
gtagacgatttcttcaaccggggcatcatgcgcgtggtgcccgagatgattgatggtgtt
tataaattgcaggagacggctacggctttcgaccgcttcgtcgggacggaaaaggtccgt
ggcaagatcctcattgactcatggaaagaggtcaactaa

DBGET integrated database retrieval system