KEGG   Shewanella halifaxensis: Shal_0800Help
Entry
Shal_0800         CDS       T00654                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
shl  Shewanella halifaxensis
Brite
KEGG Orthology (KO) [BR:shl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Shal_0800
Enzymes [BR:shl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Shal_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO Thi4 NAD_binding_7 AlaDh_PNT_C FAD_binding_3 NAD_binding_8 Glutaredoxin FMO-like K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABZ75375
UniProt: B0TTN2
LinkDB All DBs
Position
995018..996592
Genome map
AA seq 524 aa AA seqDB search
MLDANVKNQLSTYLQNLKHPVELVVSIDDSKKAQELKSLAADIDSLSPLISVIDQVGERT
PSMSVINPQLNSQITFAGLPMGHEFTSLVLALLHSGGHPIKLDSDVIEQIRQLPGEYRFE
TYVSLSCQTCPEVVQALNMMAAINPNITNVMIDGSLFQDEVNERNIMAVPSVYLNGEPFS
MGAISTVEILNKLDVNAAGRKAEQLNEKEAFDVLVVGGGPAGASAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHEYDVDIMDNQRALSLKSGELFELA
LESGAVLRSKTILLATGARWREMNVPGEQEYRGSGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDKTLRADEVLQRKAKSMGNIDIITEAMTTEVTGDGKRVNG
LNYTDRATGESHHVDLAGIFVQIGLVPNSEWLKDTIDMTARGEIVVDAKGETSLPGVFAA
GDVTNSAYKQIIIAMGSGATASLGAFDYLIRHDVDESSRDNVAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacgtaaagaatcaactgagcacttatttgcaaaacctcaagcatcca
gttgagctggttgtatctattgatgacagtaaaaaagcccaagagttaaagtcacttgct
gcagatatcgatagcttgtctccactcatctcagtaatagatcaagtgggtgagcgtact
ccttcgatgtcagtcatcaatccacaattgaatagtcagatcacctttgcaggcctgcct
atgggtcatgagtttacctccttggtgcttgcgcttctgcatagcggcggtcacccaatc
aagctagatagcgacgtgattgaacaaattcgccagctaccgggtgagtatcgtttcgag
acctatgtgtctttaagctgtcaaacctgtcctgaagtggttcaagcgctgaatatgatg
gcggcgattaacccgaacattactaacgtgatgattgatggttcactattccaagatgaa
gtgaatgagcgcaacatcatggcggtcccttctgtgtacctcaatggcgagccgttctca
atgggcgccattagcacggttgagatcttaaacaagcttgacgtcaatgcggcgggtcga
aaagctgagcagctaaacgagaaagaagcgtttgatgtattagtggttggcggtggccca
gcaggcgcatcggcagcaatttatgcggcacgtaaaggtctacgtactggcatagttgcc
gataagtttggtggtcaagtcgctgaaaccgtgggtatcgaaaacttcatttcagttaag
gcgacagaaggccctaagctggtggctaatcttgaggcccacgtacatgagtacgatgtt
gatattatggataatcaacgcgcgttgagcctaaagtcgggtgagctgtttgagttagcg
cttgaaagcggcgcggtgctgcgcagtaaaacaatattactggcaacgggggcacgctgg
cgtgaaatgaacgtaccgggtgagcaagaataccgtggtagtggtgtggcgtactgccca
cattgtgacggcccactgtttaaaggtaagcgtgttgcggttattggcggtggcaactct
ggtattgaagcggcaattgatttagcgaatattgttgagcacgttaccgtacttgaattt
gataaaacattgcgtgccgatgaagtgctgcagcgtaaagcaaagtcgatgggcaacatt
gatatcattaccgaggcgatgaccactgaggtgactggcgatggtaagcgtgttaacggc
cttaactataccgacagagccacaggcgagagccatcatgttgacctggcaggtatcttt
gtacagattggtttggtaccaaactctgagtggctaaaagacaccatagatatgacagcg
cgcggtgagattgttgtcgatgcaaaaggcgaaacttcattacctggggtatttgctgcg
ggtgatgtgacaaactcagcttataagcagattattattgccatggggagtggtgcaacg
gcatcactgggtgcatttgactacttaattcgtcacgatgtcgatgagtctagccgagat
aatgttgcagcctaa

DBGET integrated database retrieval system