KEGG   Shewanella halifaxensis: Shal_2336Help
Entry
Shal_2336         CDS       T00654                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
shl  Shewanella halifaxensis
Brite
Enzymes [BR:shl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Shal_2336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABZ76895
UniProt: B0TVL0
LinkDB All DBs
Position
2821439..2822023
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAQNALEPHISEETINYHYGKHHNTYVVKLNGLIEGTDLEQKSLEEIIKTS
TGGIFNNAAQIWNHTFYWNCLSPNGGGEATGPVADAIIAAFGSFEAFKAQFTDAAVNNFG
SAWTWLVKKADGTVAIVNTSNAATPLTDEGVTPIMTVDVWEHAYYIDYRNVRPDYLAHFW
ELVNWEFVNTNFAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattacctgcattaccttacgcacaaaacgcacttgagccacatatctca
gaagaaacgattaactaccattacggtaagcatcacaacacttatgttgttaagcttaac
ggtttaattgaaggcacggatcttgaacaaaagagcctagaagagatcatcaagacctct
actggtggcatctttaacaatgctgctcaaatttggaatcacaccttctactggaactgt
ctatcaccaaatggtggcggcgaagcaactggccctgtagccgatgcaatcattgctgca
tttggatcatttgaggcatttaaagctcagtttacggatgctgcggtaaacaactttggc
agtgcctggacatggttagttaagaaggctgacggcactgttgctattgttaatactagc
aatgctgcaacacctcttacagatgaaggtgtaacaccaatcatgacagtagatgtatgg
gaacatgcttactacatcgattaccgtaatgtgcgtcctgattatttagcgcacttctgg
gaattagttaactgggaatttgttaacacaaatttcgctggttaa

DBGET integrated database retrieval system