KEGG   Shewanella halifaxensis: Shal_2490Help
Entry
Shal_2490         CDS       T00654                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
shl  Shewanella halifaxensis
Pathway
shl00020  Citrate cycle (TCA cycle)
shl00190  Oxidative phosphorylation
shl00650  Butanoate metabolism
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
shl01130  Biosynthesis of antibiotics
shl01200  Carbon metabolism
Module
shl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
shl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:shl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shal_2490
   00650 Butanoate metabolism
    Shal_2490
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Shal_2490
Enzymes [BR:shl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Shal_2490
    1.3.5.4  fumarate reductase (quinol)
     Shal_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_16 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: ABZ77047
UniProt: B0TK28
LinkDB All DBs
Position
complement(2994789..2995496)
Genome map
AA seq 235 aa AA seqDB search
MKLEFAVYRYNPDVDTKPYMKDYSLEVEEGTDMMVLDALLKLKELDPTLAFRRSCREGVC
GSDGINMNGKNGLACITPVSTFKGNKIEIRPLPGMPVVRDLIVDLTQFYTQYEKIKPFLI
NDEKTPAREHLQSPEEREHLDGLYECIMCACCSTACPSFWWNPDKFIGPSGLLHAYRFLI
DSRDTATEERLSGLDDAYSVFRCHGIMNCIDVCPKGLNPTKAIGHIKSMLLQRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggaatttgcagtttatcgctacaatcctgatgtagatactaagccgtatatg
aaggattacagcttagaagtggaagaaggtactgacatgatggtactggatgcgctttta
aagcttaaagagttagacccaacactggcgtttagacgctcatgccgtgaaggtgtgtgt
ggcagtgatggtatcaacatgaatggtaaaaacggtctcgcatgtatcacgcctgtttcg
accttcaaaggtaacaagattgaaatccgcccactaccaggcatgcctgtagtacgtgat
ttgattgtggacctgactcagttctatacccagtacgaaaagattaagcctttcttgatt
aacgatgagaaaacacctgcgcgtgaacatctgcaatcacctgaagagcgtgagcattta
gatggactctacgagtgtatcatgtgtgcatgttgttctacggcttgtccttcattctgg
tggaatccagataagttcatcggaccgagcggtttactccacgcttatcgcttcttgatc
gatagccgtgatacggcgacagaagagcgtttatctgggcttgatgacgcatacagcgtg
ttccgctgtcatggcatcatgaactgtattgacgtttgtcctaaagggctcaacccgaca
aaagcaattggacacattaagtcaatgcttctgcagagagccgtttag

DBGET integrated database retrieval system