KEGG   Shewanella halifaxensis: Shal_2491Help
Entry
Shal_2491         CDS       T00654                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
shl  Shewanella halifaxensis
Pathway
shl00020  Citrate cycle (TCA cycle)
shl00190  Oxidative phosphorylation
shl00650  Butanoate metabolism
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
shl01130  Biosynthesis of antibiotics
shl01200  Carbon metabolism
Module
shl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
shl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:shl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shal_2491
   00650 Butanoate metabolism
    Shal_2491
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Shal_2491
Enzymes [BR:shl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Shal_2491
    1.3.5.4  fumarate reductase (quinol)
     Shal_2491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA HI0933_like Pyr_redox_2 DAO FAD_binding_3 Thi4 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ABZ77048
UniProt: B0TK29
LinkDB All DBs
Position
complement(2995509..2997275)
Genome map
AA seq 588 aa AA seqDB search
MSIPVREFDAVVIGAGGAGMRAALQISKEGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDFIGDQEAIEFMCKTGPEAVIELEHMGLPFSRFENGTIYQRPFG
GQSRNFGGEQAARTAAAADRTGHALLHCLYQQNVKHKTEVFSEWYALDLVKNEDGVIVGC
TAIEIETGEIVYFKAKATILATGGAGRIYASTTNAHINTGDGVGMAMRAGVQMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLASRDVVARSMMTEIREG
RGLDGPLGPHCLLKLDHLGKETLEARLPGVCELSRTFAHIDPADGPIPVLPTCHYMMGGL
PAKVSGQVVRQNSDGSEEEVTGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGQHLG
KALDETPIAKDATEADIDASLARLNRWESNKNGEDPAVIRKDLQLCMQLNFSVFRSGDAM
AEGLKELKAIRERLANAKLSDNSTEFNTQRIECLELDNLMATAIATATAANFRTESRGAH
SREDYLDRDDENWLCHSIYDPVTELMTKRDVNMQPKLRDAFPPIKRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattcctgttcgcgaatttgacgcggttgtaatcggtgctggtggcgctggtatg
cgtgccgctctacagatctctaaagaaggtaagagctgtgcgctgttatctaaagtattc
ccaacccgttctcataccgtatctgcccaggggggtattactgtagcccttggtaatgcc
cacgaagatcattgggaacagcatatgtacgacaccgtgaaaggctccgattttatcggt
gaccaagaagcgattgagtttatgtgtaagacgggccccgaggcggtgattgaacttgag
catatgggattacccttctctcgttttgaaaacggtactatttatcagcgcccatttggt
ggccaatctagaaattttggtggcgagcaggctgctcgtactgcagcagcggctgaccgt
accggtcacgcactgcttcactgcctgtaccagcaaaacgttaagcataaaacggaagtc
ttttctgagtggtatgcactcgatttagttaaaaatgaagacggcgtgattgtgggttgt
accgctatcgaaattgaaaccggcgaaattgtctatttcaaagccaaagcaacgatttta
gcgaccggtggagcagggcgtatttacgcatcaaccactaacgctcatatcaacactggt
gacggtgtcggcatggcgatgcgcgctggcgttcagatgcaagacatggaaatgtggcag
ttccacccaacgggtattgctggcgcaggtgttttggtgactgaaggttgtcgtggtgaa
ggtggatatctgctaaacaaagacggcgagcgctttatggagcgttatgcgccaaacgcg
aaagatttggcatcacgagacgtggtagcacgctctatgatgactgaaattcgcgaaggt
cgaggtctcgatggcccattaggcccgcattgcttacttaagcttgatcacttaggtaaa
gaaacccttgaagctcgtcttcctggtgtttgtgaactgtctcgcaccttcgcacatatc
gatccagccgatggcccaatccccgttttgccgacttgccactatatgatgggtggtcta
cctgctaaagtcagtggccaggtcgtacgccaaaattcagatggcagtgaagaagaagta
accggtctatttgcggttggcgaaattgcgtgcgtatcggtacacggagcgaacagattg
ggtggtaactcattgttagatcttgtagtatttggtcgagcagcgggtcaacatttaggt
aaagcgctggacgaaactccaattgctaaagatgcaactgaggccgatattgatgcttct
ctagcacgcttgaaccgctgggaaagcaacaagaatggcgaagatcctgcggtgatccgt
aaagacctacagctttgtatgcaacttaacttctcggtatttagaagtggtgatgcgatg
gctgaaggccttaaagagcttaaggcgattagagagcgtttggcgaatgccaagctttct
gataactcaacagaatttaatactcagcgtatcgaatgcttagaattagataacttgatg
gcaacggcaattgctacggcgacagcggcgaacttccgtactgaaagtcgtggtgctcac
tctcgtgaagactatctggaccgagatgatgaaaactggctatgtcacagtatttatgac
ccagtcaccgagcttatgactaagcgcgatgtgaacatgcagccaaagcttcgtgatgca
ttcccgccaatcaagcgtacttactaa

DBGET integrated database retrieval system