KEGG   Shewanella halifaxensis: Shal_4095Help
Entry
Shal_4095         CDS       T00654                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
shl  Shewanella halifaxensis
Pathway
shl00620  Pyruvate metabolism
shl00680  Methane metabolism
shl01100  Metabolic pathways
shl01120  Microbial metabolism in diverse environments
shl01200  Carbon metabolism
Module
shl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:shl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shal_4095
  09102 Energy metabolism
   00680 Methane metabolism
    Shal_4095
Enzymes [BR:shl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Shal_4095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 EcoR124_C
Motif
Other DBs
NCBI-ProteinID: ABZ78635
UniProt: B0TL90
LinkDB All DBs
Position
4983406..4986042
Genome map
AA seq 878 aa AA seqDB search
MVDMYASLRSNVGTLGQILGDTIRTDLDDTFLDKIEQIRHLAKSSRQGDSAARKEMLTLL
SSLSDDELVPFAKAFNQFLNLANIAEQFHTISRNCDELVCVPDPVEQLLGRMLGGNIDQE
KVLACLKTLDIDLVLTAHPTEISRRTLIQKYSAVIDSLTAQENTQLTEQEKKQHHLRLRQ
LIAQIWHTNEIRNERPTPVDEARWGLCTIEASLWQAVPDFLRQLNQQVEERTNTQLPTDI
APVRFSSWMGGDRDGNPFVTSAVTQEVLDRNRHTAARLYLKDVVLLVNELSMEGANEALL
AYTNNSNEPYRDVLRTLRQKLRNTIDYLNGRLEGQHPDVDPSEIIWHESDLKDPLMMLYQ
SLCDRGMSLIANGLLLDMLRRIACFGIHMLRLDVRQDADRHADVIAELTRYLGMGDYAHW
DETEKQSFLLRELSSKRPLIPANWQASPEVEEVVKTCRLVATQPARAMGSYVISMASQPS
DVLAVLLLLKETGCPHPMRVVPLFETLDDLNNASACMSALFSIDWYRGYTKGIQEVMIGY
SDSAKDAGVMAAAWAQYTAQEKLVAISQEANIKLTLFHGRGGTIGRGGGPAHEAILSQPP
GSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTSAVMEATLLPPPEPKPEWRQCMQQLA
EESVLAYRAIVREEPDFVSYFRAATPEIELGKLPLGSRPAKRRVDGGIESLRAIPWIFAW
SQNRLMLPAWLGAGEALKAASERGDLPLLQEMEKHWPFFKTRISMLEMVYAKAEPNLSKF
YETSLVPKELHHLGVQLRERLAIGIEAVLELTQAESLMAHTPWNRESVELRNPYIDPLNF
LQAELLARTRREEQSSKNVELALMLTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggtagacatgtatgcctcgctaaggtctaacgttggaaccttagggcagattttaggt
gacacaatccgcacggatcttgatgacactttcttagataaaatagaacaaatccgccat
cttgcaaaaagctcacgccaaggcgatagtgctgcacgtaaagagatgctgactttgcta
tcttctttaagcgatgatgaactcgttccttttgctaaggcttttaaccaatttttgaat
ctggcgaatatcgctgagcaattccataccattagccgtaattgtgacgagttagtctgt
gtacccgatccagtcgagcaactactagggcgcatgctaggcggaaacatcgaccaagag
aaggtgttagcttgtctaaagacgctagatatcgatcttgtattaactgcgcatccaacg
gagatctctcgccgcactctcattcagaagtattcagcggttattgattcactaacagcg
caagaaaacactcagcttacagaacaagagaaaaaacagcaccacctacgtttacgtcaa
ctgattgcgcagatctggcatactaatgagatccgtaacgaacgtccaacaccagtcgat
gaagcacgctggggtctatgcacaatcgaagcctctttatggcaagctgttccagatttt
cttagacagctaaaccaacaggtcgaagagcgtaccaatacccagcttcctaccgatatt
gcaccagtaaggttctcaagttggatgggcggcgaccgcgatggcaatccatttgtcact
tctgccgtgacccaagaggtcctagatcggaaccgtcatactgcagcacgcctatatcta
aaagatgtagtattactggtcaatgagctatcgatggaaggagcaaatgaggctctactg
gcttacaccaataacagcaatgagccttatcgagatgtgcttagaacacttcgtcaaaag
cttagaaatacgattgattatctaaacggcagactcgaaggtcaacatccagatgttgac
ccgagcgagattatttggcatgaaagtgatctaaaagatcctttgatgatgctatatcaa
agcctctgcgaccgtggcatgagcctaatcgccaacggtttattgcttgatatgctacgt
cgtatcgcctgttttggcattcatatgctaagactcgatgtgcgccaagatgccgatcgc
catgcagatgtgattgcagagctgactcgctatttaggtatgggcgactatgcacattgg
gatgaaaccgagaagcaatctttcttactacgcgagctcagcagtaagcgacctttgatc
ccggcaaactggcaagcatcgccagaagttgaagaggtggtgaagacttgcagactggtt
gcaacacaaccagctagagctatgggctcctatgttatctctatggctagccaaccttct
gacgtattggctgttcttttactgctaaaggaaacgggctgcccacatccaatgcgtgtt
gtaccgttatttgagaccttagatgacttaaataatgcatcggcttgtatgtctgcactg
tttagcatcgattggtaccgtggttataccaagggcattcaagaggtcatgattggttac
tctgactcggctaaagatgcgggagtgatggcagcagcttgggcgcaatatactgcgcaa
gaaaagttagtagccattagccaagaagccaatattaaactcaccctgttccatggtcgt
ggcggcacgattggccgtggcggcggaccagcacatgaggcgattctgtctcagcctcca
gggtctgtagacggtcgcatcagagtcaccgagcaaggtgaaatgatccgctttaagttt
ggcttaccaaagcttgccgttcaaagccttgcgctatatacctcagctgtaatggaggca
accctattgccaccacctgagcctaagccagagtggcgccaatgtatgcagcaactcgcc
gaagaatcggtacttgcctaccgcgctatcgtgcgtgaagagccagactttgtgtcctac
ttccgtgcggcaaccccagagatcgaattaggtaaactgccattaggtagtcgcccagct
aaacgtcgagtcgatggcggtatcgagagcttacgcgcaatcccttggatcttcgcttgg
tcgcaaaaccgtttaatgctaccagcttggttaggcgccggagaggcattaaaagcagca
tcagagcgaggtgacttaccactcctacaagagatggaaaagcattggccattcttcaag
actcggatctctatgttagaaatggtctatgccaaagccgaacctaacttgtctaaattc
tatgaaacaagcctagtgccaaaagagttacatcatcttggggtgcaactaagagagcgt
ttagccattggcatcgaagccgtactggagttaacacaagcagagagcttaatggctcat
acgccatggaaccgcgaatctgttgagctaagaaacccctacattgatccactaaacttc
ctgcaggctgaattgttagcgagaacgcgtagagaggagcaatcttctaaaaatgttgag
ctggcgctgatgttaaccatagctggtgttgccgccggaatgagaaatacaggttaa

DBGET integrated database retrieval system