KEGG   Shewanella sp. MR-7: Shewmr7_0783Help
Entry
Shewmr7_0783      CDS       T00389                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Shewmr7_0783
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shm02000]
    Shewmr7_0783
Enzymes [BR:shm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Shewmr7_0783
Transporters [BR:shm02000]
 Other Transporters
  Pores ion channels [TC:1]
   Shewmr7_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABI41783
UniProt: Q0HYM2
LinkDB All DBs
Position
894660..895289
Genome map
AA seq 209 aa AA seqDB search
MITLYGTPRSRALRVSWVLEELGAEWAFSFVDMNKGEHRSAAFLALNPCGKVPVLTDDNL
VLSESAAICLYLAEKFGNLLPEAGSAASGLHHQWVSFIITELEQPLWTMGKHKFALPEAQ
RHPSIMPCAVWEFDKAAALAEAMLPDSDFLLGDTLSVADILLAHTLMWGTLFEQQIPPKL
AAYRDRIAARPSRKSALAKMEAVANAAQA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccttatatggcacaccacgcagccgagcattacgagtctcttgggtgttagaa
gagttaggcgccgaatgggccttttcgtttgtggatatgaataagggcgagcaccgtagc
gccgctttcttagcgctcaatccctgcggcaaagtgccagtgttaaccgatgataatcta
gttttatctgagtcggcggccatttgtctgtatctggcggagaagtttggcaacttgtta
cctgaagcgggcagtgcggcatcgggtctgcatcatcaatgggtgagctttattattacc
gaacttgagcagccactgtggacaatgggcaaacataaattcgcactgccggaagcgcag
cgtcatccttctatcatgccttgcgctgtgtgggagtttgataaggcggcggccttggct
gaagctatgctgcccgatagtgactttttactcggcgataccttatcggttgccgatatt
ctgctggcgcatacactgatgtggggcaccttatttgagcagcagatcccgcctaaattg
gcggcgtatcgcgatagaattgcggcgcgtccttcgcgtaaatcggcactcgctaaaatg
gaagccgtcgccaacgcagcgcaggcttaa

DBGET integrated database retrieval system