KEGG   Shewanella sp. MR-7: Shewmr7_1647
Entry
Shewmr7_1647      CDS       T00389                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
shm  Shewanella sp. MR-7
Brite
Enzymes [BR:shm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Shewmr7_1647
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: ABI42642
UniProt: Q0HW63
LinkDB
Position
complement(1937505..1938089)
AA seq 194 aa
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIEGTDFAGKSLEEIIKTS
TGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGPVADAINAAFGSFDAFKAQFTDSAVNNFG
SAWTWLVKKADGTVAIVNTSNAATPLTDSTVTPILTVDVWEHAYYIDYRNVRPDYLAHFW
QLVNWDFVNQNFAG
NT seq 585 nt   +upstreamnt  +downstreamnt
atggctttcgaattacccgcattaccatatgcaaagaacgcactagaaccacacatttct
caagaaaccattgaataccactacggcaagcatcacaacacctacgttgttaagctaaac
ggtttaatcgaaggaaccgatttcgcaggtaaatctttagaagaaatcatcaaaacttct
actggtggcgtatttaacaacgcggctcaagtttggaaccacactttctactggaactgc
ttagcgcctaacgcaggcggtgagccaacaggtccagtagctgatgcaatcaatgctgct
ttcggttcattcgacgcattcaaagcacaatttaccgattctgccgtaaacaactttggt
agcgcttggacttggttagtgaaaaaggccgatggcactgttgctatcgttaacactagc
aatgctgctacgcctctgactgacagcactgtgacgccaatcctgactgtggacgtgtgg
gaacacgcttactacatcgattaccgcaacgtacgtcctgactatttagcccacttctgg
caattagttaactgggacttcgtgaaccaaaacttcgcaggttaa

DBGET integrated database retrieval system