KEGG   Shewanella sp. MR-7: Shewmr7_2588Help
Entry
Shewmr7_2588      CDS       T00389                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00250  Alanine, aspartate and glutamate metabolism
shm00410  beta-Alanine metabolism
shm00430  Taurine and hypotaurine metabolism
shm00650  Butanoate metabolism
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm02024  Quorum sensing
Module
shm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Shewmr7_2588
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shewmr7_2588
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shewmr7_2588
   00430 Taurine and hypotaurine metabolism
    Shewmr7_2588
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Shewmr7_2588
Enzymes [BR:shm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Shewmr7_2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase P53_tetramer
Motif
Other DBs
NCBI-ProteinID: ABI43573
UniProt: Q0HTI2
LinkDB All DBs
Position
3061519..3063168
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQAIASEDSLMRIFTVPEDAESTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPSQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYAQHDDFYRNWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGDFKGVTREGLIKALRHYGFDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTDGNNKVDVAKMREVAAELANKRIKIMAIVGVAGTTETGNIDPLRELAALASEL
NCHFHVDAAWGGASLLSNKYRHLLDGIELADSVTIDAHKQMYVPMGAGMVLFKNPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIDAHPDFELVTAPELCLLTYRYVPANVQAAMQLAIEQGYKTKLARFNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQPTVVFRVVLANPLTSHEILNQVLIEQGEIAALDKEFL
PALLAMVNE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaactccctcgccaagccatcgcatccgaagacagtttgatgcgaattttc
actgtgcccgaagatgcggaatccaccttaagcattatcgagcagaagctttccgaggac
ttagccggttttttgggtgacagcattgccgcgctagaaaagccgctctccgaaatcgag
accgattttcaagcctttgaaattccaagccagccgcgttttgtctccgactacaccgac
gaaatcatgcagaatctcgtcgcgcattcggtgcatacggcggcgcccagttttatcggc
catatgacctcggcactgccctatttcgtgttaccactgtcgaaaatgatggtggggctg
aatcaaaacttggtcaaaatcgaaacctccaaagcctttacgccgcttgagcgccaagtg
ctcggcatgatgcaccatttgatttacgctcaacacgatgatttttatcgtaattggatg
cacagtgccaaccattcccttggcgcattttgctcaggcggcactgtggctaacatcacc
gccctgtggattgcccgcaaccaattactcaaggccgatggcgactttaaaggcgtgacc
cgcgaaggcttaatcaaggcgctgcgtcactatggcttcgatgatttagcgattctggtc
tccgagcgcggccactactccttaggtaaggccgtcgatctgctcggtattggtcgcgac
aatatcatcagcatcccaaccgatggcaataacaaagttgacgttgccaaaatgcgcgaa
gtcgccgccgaactggcgaataaacgcatcaaaatcatggcgattgttggggtggctggc
accaccgagacgggcaatatcgacccactgcgcgaacttgccgccttagcaagtgagcta
aactgccacttccatgtggatgcggcttggggcggcgcaagcttattatccaataaatac
cgtcacttactcgatggtattgaactcgcagattcagtcaccatcgatgctcataagcaa
atgtatgtccctatgggcgcgggcatggtgctatttaaaaatcctgagtttgcccatgcc
attgcccaccacgccgaatatattctgcgccgaggctctaaggatttaggcagccaaacg
ctcgaaggctcacgccccggcatggcgatgttagtgcatgcctgtttgcagattatcggc
cgcgatggttatgaaatccttatcaataacagccttgaaaaagcccgttattttgccgag
caaatcgacgcacaccctgactttgagctagtcaccgcgccagagctgtgcctgctcacc
tatcgttatgttcctgcgaatgtgcaggcagcgatgcaactggcgatagaacaaggctat
aagaccaaactcgctcgctttaatgagctgctcgatggtctaacccaatttattcaaaaa
caccaacgcgaacagggtaaatcctttgtctcccgcacccgcattcaacccgcgcgctac
tttagacaacccacagtggtgtttcgcgtggtattagctaatcctttgactagccatgag
atccttaatcaagtgcttatcgagcaaggcgaaattgccgcattggataaagagttctta
cctgcgctattagctatggtcaatgaatag

DBGET integrated database retrieval system