KEGG   Shewanella sp. MR-7: Shewmr7_3223Help
Entry
Shewmr7_3223      CDS       T00389                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
shm  Shewanella sp. MR-7
Brite
KEGG Orthology (KO) [BR:shm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Shewmr7_3223
Enzymes [BR:shm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Shewmr7_3223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like DAO Thi4 NAD_binding_7 Glutaredoxin FAD_binding_3 AlaDh_PNT_C K_oxygenase FMO-like Spermine_synth NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABI44207
UniProt: Q0HRP8
LinkDB All DBs
Position
3816560..3818137
Genome map
AA seq 525 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESRKSQELKSLANDIVSLSTLVSLKEAQGPRT
PAMTVVNPELNTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDEIIEQIRNLPGKYEFE
TYVSLTCQNCPDVIQALNMMAAINPNITNVMIDGALFQDEVASRNIMAVPSVYLNGEAFA
AGRISIGEILNKLDTGAASRKAEELSQKAPYEVLVVGGGPAGAAAAIYAARKGLRTGVVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVKLASDGLFELE
LASGAKLRSRTILLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSKLRADDVLQRKAASMGNIHIITEAMTTEVTGDGTRVNG
LNYTDRATGESHHIALEGIFVQIGLVPNAEWLKGTVDLTPRGEIIVDERGQTSVPGVFAA
GDVTNSPYKQIIIAMGSGANASLGAFDYLIRHSDDSTETTATKAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttgaaaaatcaactgcaaacctatctgcaaaacctcaagagacca
gttgaacttgtcgtgtcagcagatgaaagcagaaagtctcaagaattaaaaagcttagcc
aatgacatcgttagcctttcaacattagtgagcctcaaagaagctcaaggcccccgcacg
ccagcgatgacagtggttaacccagaactcaatactcagattagctttgctggtctgcct
atgggtcacgaatttacctcactcgtgttagccctgctgcacacgggtggacaccccatc
aaactcagcgacgaaatcattgagcagatccgtaatctgcctggcaaatatgagtttgaa
acctatgtatcactcacctgccaaaactgccctgatgtgattcaggcgctgaatatgatg
gcagcgattaacccgaacatcaccaacgtgatgatcgatggcgccctgttccaagatgaa
gtcgccagccgcaatattatggccgtaccgtctgtgtacttaaacggtgaagcatttgcc
gcgggccgcatcagcattggtgagatcttaaataaactcgatactggcgcggccagtcgc
aaagcggaagaactcagccaaaaagccccatacgaagtcttagtcgtcggtggtggcccc
gcgggtgctgcggcagcgatttatgccgcccgtaaaggtctacgtaccggtgtggtagcc
gataaattcggtggccaagtcgccgaaactgtaggtatcgaaaactttatttcggttaaa
gcgactgaaggtccaaaactggtggcaaaccttgaagcccatgtgcgtgactatgaagtc
gatatcatggataaccaaaaagccgttaaactggcgagcgatggcttattcgaacttgaa
ttggcaagtggcgctaaactgcgcagccggaccatactactggcaaccggtgctcgctgg
cgcgaaatgaatgttcccggcgagaaagaataccgtggtaaaggtgtggcttactgccca
cactgtgacggcccattatttaaaggcaaacgtgttgcagtgatcggtggtggtaactca
ggtatcgaagcggcaatcgacttagccaacatcgttgagcatgtcactgtactcgagttc
gatagcaaactgcgcgccgatgatgtgctgcaacgtaaagcggcctctatgggtaatatc
catattattacggaggcgatgacgactgaagtgacaggtgacggtacccgtgtaaacggc
ctgaactacaccgaccgtgcaacgggtgaaagccaccatatcgcgctggagggtatcttc
gtccaaatcggtttagtgcccaatgccgaatggttaaaaggcactgtggatttgactcct
cgtggcgaaatcatcgtcgatgagcgcggccagacctcagtaccaggcgtatttgccgca
ggtgacgtgactaactcaccttacaagcaaatcatcatcgccatgggtagcggtgccaat
gcctcactgggtgcatttgattacttaattcgccatagcgatgacagtaccgagaccaca
gcaactaaagcggcttaa

DBGET integrated database retrieval system