KEGG   Shewanella sp. ANA-3: Shewana3_0024Help
Entry
Shewana3_0024     CDS       T00428                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00071  Fatty acid degradation
shn00280  Valine, leucine and isoleucine degradation
shn00281  Geraniol degradation
shn00310  Lysine degradation
shn00362  Benzoate degradation
shn00380  Tryptophan metabolism
shn00410  beta-Alanine metabolism
shn00640  Propanoate metabolism
shn00650  Butanoate metabolism
shn00903  Limonene and pinene degradation
shn00930  Caprolactam degradation
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn01130  Biosynthesis of antibiotics
shn01200  Carbon metabolism
shn01212  Fatty acid metabolism
Module
shn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:shn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Shewana3_0024
   00650 Butanoate metabolism
    Shewana3_0024
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Shewana3_0024
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shewana3_0024
   00310 Lysine degradation
    Shewana3_0024
   00380 Tryptophan metabolism
    Shewana3_0024
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shewana3_0024
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Shewana3_0024
   00281 Geraniol degradation
    Shewana3_0024
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shewana3_0024
   00930 Caprolactam degradation
    Shewana3_0024
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Shewana3_0024
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Shewana3_0024
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Shewana3_0024
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Shewana3_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DUF957
Motif
Other DBs
NCBI-ProteinID: ABK46269
UniProt: A0KR50
LinkDB All DBs
Position
complement(29437..31587)
Genome map
AA seq 716 aa AA seqDB search
MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLASLDAALDSIKQQSNIQALVLTSG
KDTFIVGADITEFLGLFAQDDAVLLSWIEQANAVFNKLEDLPFPTASAIKGFALGGGCET
ILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRPEDALK
VGAVDAVVAPEALEAAAIQMLKDAVAEKLDWQARRQRKMSPLTLPKLEAMMSFTTAKGMV
FAVAGKHYPAPMAAVSVVEQAATKGRSDALQIEHQAFIKLAKTDVAKALIGIFLNDQLVK
GKAKKAGKLAKDVKSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEAAKLL
SAQVARGRSTPEKMAKVLNNITPALDYAPVKHADVVVEAVVEHPKVKAQVLAEVEQYVSE
DAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMGKSGNDAIDVMFENKRLGQKNGKGFYAYSVDSRGKP
KKDVDPTSYELLKAAFGEQKAFDADEIIARTMIPMIIETVRCLEEGIVASPAEADMGLVY
GLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRALAANNGSYYQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagtcctacaattcaggttgagttactcgaggataatattgccaagctg
tgctttaacgcacccggttcggtgaacaaattcgacagagaaacactcgcctcactcgat
gccgcattagacagcattaaacaacaatcaaacattcaggctttagtgctgacctcaggt
aaagatacctttatcgtgggtgccgacattactgaatttttaggcttattcgcacaggat
gatgcggtactgctctcttggattgaacaggccaacgccgtattcaacaagctcgaagat
ttacctttcccaaccgcttcagcgattaaaggtttcgccctaggcggcggttgtgaaact
attctggcaacggatttccgtatcgccgacaccacagccaaaatcggcctacctgaaacc
aaactgggcattatcccaggctttggtggcacagtgcgtttacctcgtgtgattggtgcg
gataacgcccttgagtggatcaccacgggtaaagatcagcgtccagaagatgccttaaaa
gtcggtgctgtcgatgccgttgttgcgccagaggctttagaagccgccgccattcaaatg
ctaaaagatgcagtagcagaaaagcttgattggcaagcccgtcgccaacgtaagatgtca
ccactgaccttaccaaaactcgaagccatgatgtcttttactaccgctaaaggcatggtg
tttgcggttgcgggtaaacactaccctgcaccaatggcggcagtcagcgttgttgaacaa
gctgcgaccaaaggccgcagcgacgcactgcaaattgaacatcaagcgtttatcaagtta
gcgaaaaccgatgtagccaaggcgttgatcggtatcttcttgaatgaccaattagtcaaa
ggcaaagctaaaaaagcaggcaaactcgccaaagatgtgaaaagcgccgccgtattaggt
gctggcatcatgggtggcggtatcgcttaccaaagcgccagcaaaggcacgccaatagta
atgaaggatatcgctcaacctgcattagatttaggtttaggcgaagccgctaaactgtta
tctgcgcaagttgctcgcggccgctctaccccagaaaaaatggctaaggtgctgaacaac
atcactccagccttagactatgctccagttaaacatgctgacgtggttgtcgaagccgta
gttgagcatccaaaagtgaaggcacaagtactggcggaagttgaacaatacgtgagtgaa
gatgcgattatcgcctctaacacgtcaaccatttcaatcaacctgctcgcgaaaagcatg
aagaagcctgagcgtttctgcggtatgcacttctttaaccctgtgcacaaaatgccattg
gttgaagttattcgtggcgagcacagctcagaagaaaccatcgcatctgttgttgcctac
gccagcaaaatgggtaaaaccccaatcgttgttaacgattgcccgggtttcttcgttaac
cgcgtactcttcccttactttgcaggctttaacggcctgctcgccgaaggtggcgacttt
gccgctatcgataaagtgatggaaaaacaattcggctggccaatgggcccagcttacctg
ctagacgttgtcggcctagacacgggtcaccacgcgcaagcggtaatggccgaaggcttc
cccgatcgtatgggcaaatctggcaatgacgcgattgacgtgatgtttgagaacaagcgt
ctcggtcagaagaatggtaaaggtttctacgcttactctgtagatagccgtggtaaacca
aagaaagatgtcgacccaaccagctacgagctgctgaaggccgcctttggtgagcaaaaa
gcattcgatgcggatgaaatcatcgcccgcactatgatcccaatgattatcgaaaccgtt
cgctgtttagaagaaggcattgtggcatcacctgccgaagcagatatgggcttggtctat
ggtttaggtttccctccattccgtggtggtgtattccgttacttagatactatgggcgta
gcgaactttgtcgccttagctgacaaatacgctcacttaggtggtttgtatcaagtcacc
gacgccatgcgcgcccttgcagccaacaacggtagctactaccaagcctaa

DBGET integrated database retrieval system