KEGG   Shewanella sp. ANA-3: Shewana3_0329Help
Entry
Shewana3_0329     CDS       T00428                                 

Definition
(GenBank) beta-ketoacyl synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00061  Fatty acid biosynthesis
shn00780  Biotin metabolism
shn01100  Metabolic pathways
shn01212  Fatty acid metabolism
Module
shn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:shn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Shewana3_0329
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Shewana3_0329
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:shn01004]
    Shewana3_0329
Enzymes [BR:shn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     Shewana3_0329
Lipid biosynthesis proteins [BR:shn01004]
 Fatty acid synthase
  Component type
   Shewana3_0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ketoacyl-synt_C ketoacyl-synt Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ABK46572
UniProt: A0KS03
LinkDB All DBs
Position
complement(363111..364328)
Genome map
AA seq 405 aa AA seqDB search
MNNRVAITQIGLCTPLGQTPEQVLARLIAGDTSAMQTSETLLFEESTLVAPVTESLPTIP
AALAQFDCRNNQLLLAAALQIRDAVEQAKGEFGADRIGVVLGTSTSGISKGEAALAYRNQ
HGHFPADYHYFQQELGSTSDFLRQLFELQGPCYTISTACSSSAKVFASAKRLLEAKLCDM
VIVGGIDSLCQLTVNGFHALESVSKGHCNPFSANRDGINIGEGAALFTLTLATDNTANEA
CVLLAGIGESSDAHHMSAPHPEGAGAIAAMQAALDDAQISAQQIDYINLHGTATPKNDAM
ESRAVASVFGDTPPPASSTKPLVGHTLGAAGAIEAAFCYLLLSPHNHHLALPPHRFDGQP
DPQDPSIALVAPKQCAEHGRLNYVMSNSFAFGGSNACLIFCRKGA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacagagtcgccattacacaaattggattgtgtaccccgttagggcaaacgccc
gagcaggtgttagcccgcttgattgcaggcgataccagtgccatgcaaaccagtgaaacc
ctgctatttgaggagtcgacactggttgcgcccgtcactgagtcgttaccgacgatacct
gccgcgctggcgcaattcgattgtcgcaataatcagttgctccttgctgccgcactgcaa
attcgcgatgccgtagagcaagccaaaggtgagtttggcgccgaccgtatcggcgtggtc
ttaggcaccagcacctcgggaatttcgaaaggcgaagccgccttggcctatcgcaatcaa
cacggccacttccccgccgattaccattatttccagcaggaactcggtagcaccagcgat
tttctacgccagttatttgagctccaaggcccttgctacaccatttcgaccgcctgctcc
tctagcgccaaggtatttgccagcgccaaacgcctactcgaggccaagctgtgcgatatg
gtgatcgtcggcggtatcgacagcctgtgccaactgacagtcaacggatttcacgcctta
gaatcggtttccaagggacattgcaaccccttcagcgccaaccgcgatggcatcaatatc
ggtgaaggcgccgcgctatttactctgaccttagcgacagacaacacagcaaatgaagcc
tgcgttttgcttgcaggcataggcgagtcgagcgatgcgcaccatatgtcggcgccacat
cccgaaggtgcgggggcaattgccgccatgcaggccgcgcttgatgatgcacagatatcg
gcgcaacagattgattatataaacttacatggtacagcaacgcctaaaaatgatgcgatg
gaaagccgtgccgtagcctcggtatttggcgacacgccgccacccgcaagctcaaccaaa
ccgctggtcggccataccttaggtgccgcgggcgcgattgaagccgcattttgttattta
ctgctctcaccccataatcaccatcttgccctgcctccccacaggtttgatgggcagcca
gatccacaggatcccagcatagccttagtcgcgcccaaacaatgtgccgagcatggcagg
ctgaactatgtgatgagcaactccttcgcctttggcggcagcaatgcctgcctgattttt
tgccgtaaaggggcttaa

DBGET integrated database retrieval system