Shewanella sp. ANA-3: Shewana3_0343 Help Entry Shewana3_0343     CDS       T00428                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism shn  Shewanella sp. ANA-3 Pathway shn01100   Metabolic pathways shn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Shewana3_0343   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Shewana3_0343 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ABK46586 UniProt:  A0KS17 LinkDB All DBs Position complement(377240..377488) Genome browser AA seq 82 aa AA seqDB search MQNREQILAMLTTILVDEFEIDADAITTEANLYQELDLDSIDAVDLVIKLQQLTGKKIQP DEFKSVRTVNDVVNAIEGLVKD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaaccgcgaacaaatcctcgctatgttgaccacgattttggtggatgagtttgaa atcgatgccgatgcgattacgacagaggcgaatctctaccaagagttagatctggacagc atagatgccgtcgacttagtgattaagctgcagcaactcacgggcaagaaaattcagccc gacgagtttaaatctgtccgcacagtcaacgatgtggttaatgccattgaaggcttagtt aaagactaa

DBGET integrated database retrieval system