KEGG   Shewanella sp. ANA-3: Shewana3_1639
Entry
Shewana3_1639     CDS       T00428                                 

Definition
(GenBank) manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
shn  Shewanella sp. ANA-3
Brite
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Shewana3_1639
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: ABK47872
UniProt: A0KVQ3
LinkDB
Position
complement(1930754..1931338)
AA seq 194 aa
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIEGTDFAGKSLEEIIKTS
TGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGPVADAINAAFGSFDAFKAQFTDSAVNNFG
SAWTWLVKKADGTVAIVNTSNAATPLTDSTVTPILTVDVWEHAYYIDYRNVRPDYLAHFW
QLVNWDFVNQNFAG
NT seq 585 nt   +upstreamnt  +downstreamnt
atggctttcgaattacccgcattaccatatgcaaagaacgcactagaaccacacatttct
caagaaaccattgaataccactacggcaagcatcacaacacctacgttgttaagctaaac
ggtttaatcgaaggaaccgatttcgcaggtaaatctttagaagagatcatcaagacttct
actggtggggtatttaacaacgcagctcaagtttggaaccacactttctactggaactgc
ttagcgcctaacgctggcggtgagccaacaggtcctgtggctgatgcgatcaatgctgca
ttcggttcattcgacgcattcaaagcacaatttaccgattctgcggtaaacaactttggt
agcgcttggacttggttagtgaaaaaagccgatggcactgtagctatcgttaacactagc
aatgctgcaacgcctctgactgacagcactgtgacaccaatcctgactgttgacgtgtgg
gaacacgcttactacatcgattaccgcaacgtacgtcctgactacttagcccacttctgg
caattagttaactgggacttcgtgaaccaaaacttcgctggctaa

DBGET integrated database retrieval system