KEGG   Shewanella sp. ANA-3: Shewana3_2643Help
Entry
Shewana3_2643     CDS       T00428                                 

Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00270  Cysteine and methionine metabolism
shn00450  Selenocompound metabolism
shn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Shewana3_2643
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Shewana3_2643
Enzymes [BR:shn01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     Shewana3_2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 Met_gamma_lyase GDC-P Beta_elim_lyase SelA
Motif
Other DBs
NCBI-ProteinID: ABK48870
UniProt: A0KYK1
LinkDB All DBs
Position
complement(3156336..3157529)
Genome map
AA seq 397 aa AA seqDB search
MQDESSKQWKAATQAIHAGHEREAFGTLVTPLYQTATFVFESAQQGGERFAGNEPGYIYT
RLGNPTVAELERKMAILEGAEAAAATASGMGAVSAALLANLQMGDHLVASNAVYGCTFAL
MTSQFARFGIEVTLVDFTDLAAIERAIKPNTRVIFCETPVNPHLQVFDLKGIADIAKRHQ
LVSIVDNTFMTPLLQQPLAFGIDLVVHSATKYLNGHGDVIAGVVCGSEEQLHRVKYEILK
DIGAVMSPHDAWLILRGLKTLDVRLQRHCDSAQRVAEFLEQHPAVTRVYYPGLKSHSGHR
FIGGQMAKAGGVIAFELAASLEQAMAFVGYLKLFSIAVSLGDAESLIQHPASMTHSPYTP
EARQAAGISDNLLRISIGLEDCGDIIEDLNQALAMLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgaatcaagcaagcagtggaaagccgcgacccaagctattcatgccgggcat
gagcgagaagcttttggtactttggtgacgccactttatcaaacggcgacttttgttttt
gagtcggcgcagcaaggcggcgagcgatttgccggcaacgaacccggttatatttatact
cgcctaggtaacccgaccgttgccgagctggaacgtaaaatggcgattttagaaggcgct
gaagcggcggcagcaacggcctctggcatgggtgctgtgtcggcggcgctgctggctaac
ttgcagatgggcgatcatttagtggcttccaatgcggtttatggttgcacctttgccctt
atgactagccaatttgcccgcttcggtatcgaagtcaccttagtcgattttaccgattta
gcggccattgaacgggctatcaaacccaacactcgggtgattttttgcgaaactccggtt
aatcctcatttacaggtgtttgatctcaaaggtatcgccgatattgcgaaacggcatcaa
cttgtcagcattgtcgataatacttttatgacaccgttactgcagcaacccttagcattc
ggtatcgatttagtggtacacagtgcgactaagtatttgaatgggcacggcgatgtaatt
gctggcgtcgtgtgtggcagtgaagagcagctgcacagagtgaaatatgagattctaaag
gatatcggtgctgtgatgtctccccacgatgcgtggctgattttgcgagggctaaaaacc
ttagatgtgcgtttgcagcgccattgtgacagtgcgcagcgtgtcgccgagtttttggag
caacatcccgcagtgactcgggtgtattatcccgggcttaaatcccattcagggcatcga
tttatcggtggacagatggcgaaagctggtggcgtgattgcctttgagttagccgcctct
cttgagcaagcgatggcttttgtgggttaccttaagctgttttcaatcgctgtaagtttg
ggggatgcggaatcccttattcagcacccagcttccatgacccactcaccctacacgcca
gaggcacgccaggcagcgggaataagcgataatttactgcgcatctcaatcggtttagag
gattgcggcgatatcatcgaggatttaaaccaagctttggcgatgctggcgtaa

DBGET integrated database retrieval system