KEGG   Shewanella sp. ANA-3: Shewana3_2686Help
Entry
Shewana3_2686     CDS       T00428                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00250  Alanine, aspartate and glutamate metabolism
shn00410  beta-Alanine metabolism
shn00430  Taurine and hypotaurine metabolism
shn00650  Butanoate metabolism
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn02024  Quorum sensing
Module
shn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Shewana3_2686
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shewana3_2686
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shewana3_2686
   00430 Taurine and hypotaurine metabolism
    Shewana3_2686
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Shewana3_2686
Enzymes [BR:shn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Shewana3_2686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase P53_tetramer
Motif
Other DBs
NCBI-ProteinID: ABK48913
UniProt: A0KYP4
LinkDB All DBs
Position
3212207..3213856
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQAIASEDSLMRIFTVPEDAESTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPSQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYAQDDDFYRNWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGDFKGVTREGLIKALRHYGFDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTDGNNKVDVAKMREVAAELANKRIKVMAIVGVAGTTETGNIDPLRELAALASEL
NCHFHVDAAWGGASLLSNKYRHLLDGIELADSVTIDAHKQMYVPMGAGMVLFKNPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIDAHPDFELVTAPELCLLTYRYVPAEVQAAMQVAIDQGDKVKLARFNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQPTVVFRVVLANPLTSHEILNRVLIEQGEIAALDKEFL
PALLAMANE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaactccctcgccaagccatcgcatccgaagacagtttgatgcgaattttc
actgtgcccgaagatgcggaatccaccttaagcatcatcgagcagaagctttccgaggac
ttagccggctttttgggtgacagcattgccgcgctggaaaagccgctctccgaaatcgaa
accgattttcaagcctttgaaattccaagccagccacgttttgtctccgactataccgac
gaaatcatgcaaaatctggtggcacattcggtgcatacggcggcgcccagttttatcggc
catatgacctcggcgctgccctatttcgtgttaccactgtcgaagatgatggtggggctg
aatcaaaacttggtcaaaattgaaacctccaaagcctttacgccgcttgagcgtcaagtg
ctcggcatgatgcaccatttgatttacgctcaagatgatgatttttatcgtaattggatg
cacagtgccaaccattccctcggcgcattttgctccggcggcacagtggctaacatcacc
gccctgtggattgcccgcaaccaattactcaaggccgatggcgactttaaaggcgtgacc
cgcgaaggcttaatcaaggcgctgcgccactatggcttcgatgatttagcaattctggtc
tccgagcgcggccactactccttaggtaaggccgtcgatctgctcggtatcggtcgcgac
aatatcatcagcatcccaaccgatggcaataacaaagtcgacgttgccaaaatgcgcgaa
gttgccgccgaactggcgaataaacgcatcaaagtcatggcgattgttggggtagcaggc
acaaccgagacgggcaatatcgacccactgcgcgaacttgccgccttagcaagtgagtta
aactgccacttccatgtagatgcggcttggggcggcgcaagcttattatccaataaatac
cgtcacttactcgatggtattgaactggcagactcagtcaccatcgatgctcataagcaa
atgtatgtccccatgggcgcgggtatggtgctgtttaaaaatcctgagtttgcccatgcc
attgcccaccacgccgaatatatcctgcgccgaggctctaaggatttaggcagccaaacg
ctcgaaggctcacgccccggcatggccatgttagtgcatgcctgtttgcagattattggc
cgcgatggttacgaaatcctgatcaacaacagccttgaaaaagcccgttattttgccgaa
caaatcgacgcacaccctgactttgagctagtcaccgcgccagagctgtgcctgctcacc
tatcgttatgtacccgcggaggtgcaggccgccatgcaagtggcgatagaccaaggcgat
aaggtgaaactcgctcgctttaatgagctgctcgatggcctaacccaatttattcaaaaa
catcaacgcgaacagggcaaatcctttgtctcccgtacccgcattcaacccgcgcgctac
tttagacaacccacagtggtgtttcgcgtcgtattagctaatcctttgactagccatgag
atccttaatcgagtgcttatcgagcaaggcgaaattgccgcattggataaagagttctta
cctgcactattagctatggccaatgaatag

DBGET integrated database retrieval system