KEGG   Shewanella sp. ANA-3: Shewana3_3326Help
Entry
Shewana3_3326     CDS       T00428                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
shn  Shewanella sp. ANA-3
Brite
KEGG Orthology (KO) [BR:shn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Shewana3_3326
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Shewana3_3326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO Thi4 NAD_binding_7 Glutaredoxin FAD_binding_3 AlaDh_PNT_C K_oxygenase Spermine_synth FMO-like NAD_binding_8 Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: ABK49550
UniProt: A0L0I1
LinkDB All DBs
Position
3987431..3989008
Genome map
AA seq 525 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLANDIVSLSSLVSLKEAQGSRT
PAMTVVNTDLNTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDEVIEQIRNLPGKYEFE
TYVSLTCQNCPDVIQALNMMAAINPNITNVMIDGALFQDEVASRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTGAASRKAEELSQKAPYEVLVVGGGPAGAAAAIYAARKGLRTGVVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVKLASDGLFELE
LASGATLRSRTILLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSKLRADDVLQRKAASMGNIHIITQAMTTEVTGDGTRVNG
LNYTDRATGESHHIALAGIFVQIGLVPNAEWLKGTVDLTPRGEIIVDERGQTSIPGVFAA
GDVTNSPYKQIIIAMGSGANASLGAFDYLIRHSDDSAETTETKAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttaaaaaatcaactgcaaacctatctgcaaaacctcaagagacca
gttgaacttgtcgtgtcagcagatgaaagcaagaagtctcaagaattaaaaagcttagcc
aatgacatcgttagcctttcctctttagtgagcctcaaagaagctcaaggctctcgtacg
ccagcgatgacagtggttaacaccgatctcaatactcagattagctttgctggtctgcct
atgggtcacgaattcacctcactcgtgttagccctgctgcacacgggtggacacccaatc
aaactcagcgacgaagtcattgagcagatccgtaatctgcctggcaaatatgagtttgaa
acctatgtttcactcacctgccaaaactgccctgatgtgattcaggcgctaaatatgatg
gctgcgattaacccgaacatcaccaacgtgatgatcgacggcgccctgttccaagacgaa
gtggcgagtcgtaatatcatggccgtaccgtctgtgtacttaaacggtgaagtgtttgcc
gcaggccgtatcagcatcggtgagatcttaaataaactcgatactggcgctgccagccgt
aaagctgaagaactcagccaaaaagccccatacgaagtcttagtcgtcggtggtggcccg
gctggcgcagctgccgcgatttacgctgcccgtaaaggtcttcgcactggtgtggttgca
gataaatttggtggccaagttgccgaaactgtaggtatcgaaaactttatttcggtaaaa
gcgactgaaggtccaaaactggtggctaaccttgaagcccacgttcgtgactacgaagtc
gacatcatggataaccagaaagccgttaaactggcgagcgatggattattcgaactcgaa
ctggcaagcggtgcaacactgcgtagccgtaccatccttttggcaaccggtgcccgctgg
cgcgaaatgaatgtccccggtgagaaagaataccgtggtaagggcgtagcttactgccca
cactgtgacggcccattatttaaaggcaaacgtgttgcagtgatcggtggcggtaactca
ggtatcgaagcggcaatcgatttagccaacattgttgagcatgtgaccgtactcgaattt
gatagcaaactgcgcgccgatgacgtactgcaacgtaaagcggcctctatgggtaatatc
catatcattactcaagcgatgaccactgaagtgactggtgacggtacccgtgtaaacggc
ctgaactacaccgaccgtgcaacgggtgaaagccaccatatcgcgctggctggtatcttc
gtacaaatcggtttagtgcccaatgccgaatggttaaaaggcactgtggatttaactcct
cgtggcgaaatcatcgtcgatgagcgcggccaaacctctatcccaggtgtattcgccgct
ggtgacgtgactaactcaccttacaagcaaatcatcatcgctatgggtagcggtgccaat
gcttcactgggtgcgtttgattacctcattcgccatagcgatgatagtgccgagaccaca
gaaactaaagcggcttaa

DBGET integrated database retrieval system