KEGG   Shewanella sp. ANA-3: Shewana3_4364Help
Entry
Shewana3_4364     CDS       T00428                                 

Definition
(GenBank) manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
shn  Shewanella sp. ANA-3
Brite
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Shewana3_4364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABK50578
UniProt: A0L3E6
LinkDB All DBs
Position
p1:complement(252447..253058)
Genome map
AA seq 203 aa AA seqDB search
MITEIKPKPLSFNAAKLKGLSANLIESHWTNNYSGSVKTLNAVNDQLSQALANPDTPAFL
YNDLKREHLIRTGSVILHELYFDNLGGNGKADGELRSAFAKQFGTFDRWETEFRKIAQGL
GGGSGWVVLGYNTHFNKLENYWMGDHAHFPVGTVPLLVMDMYKHSYHMDFGAAAGKYIDA
FFNNINWDEVAHRLQATHTKTTS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgaaataaaaccaaaacctttatccttcaatgccgcaaaattaaaaggcctt
tctgccaatttgatcgagtcgcattggactaacaattacagcggttcggtaaaaacattg
aatgcggtgaatgatcagttgagtcaggcactcgcaaaccccgacacgccagcgtttctc
tacaatgatctcaagcgggagcatttgattcgcacaggctcggtcattttgcacgaatta
tattttgataacctgggcggtaatggcaaagccgatggtgaattacgctcagctttcgcc
aaacaatttggtacttttgatcgctgggaaaccgaattccgcaaaatcgctcaaggcttg
ggcggtggttccgggtgggttgttctggggtataacacgcatttcaataagctggaaaat
tattggatgggtgatcacgcacatttcccggtaggcacagttccgttgttggtcatggat
atgtataaacattcttatcacatggactttggcgcggctgccggtaaatatattgatgct
tttttcaataatattaattgggatgaggttgctcatcggctccaagccactcacacgaag
acaacatcctaa

DBGET integrated database retrieval system