KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_0111
Entry
SHJGH_0111        CDS       T02531                                 

Definition
(GenBank) nucleotidylyltransferase
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00525  Acarbose and validamycin biosynthesis
sho01100  Metabolic pathways
sho01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sho00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    SHJGH_0111
Enzymes [BR:sho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     SHJGH_0111
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 DUF4954
Other DBs
NCBI-ProteinID: AGF59777
LinkDB
Position
143659..144780
AA seq 373 aa
MDGVRAVLLAGGEGRRMGPLGRGRLKPLVPFGGTSRLIDFSIANVHRSGLRDVLLLSQYE
ERRLMDDLHLVWNGRHRGFRIDFGPYDAVYRRSPGKLPEQLPERTWPLERGTADALLTKA
EYVFRQGDAEASEILVLHADHVYRFDYGDMIREHRASKAALTVSYQRIERRYVHLFGMVE
FDGDGLLTAFEEKPDDPTSDLVFAAFCLFDAATLRRYLEQLRGTDWQHDISRDVIPAMLA
GGELIRGYEVKSYWEDIGTVDRYHRAHRGLLRADPTLALSDMPLTVAPEVPRHLVPGGPG
RRASVVAADVANEGEIVSSVVYPGARIGVDAHVVDCVVLPGAQVPDGTHLASAIVLEDGS
VQQCEAEREEVAL
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggacggagtgcgtgccgtactgctggcgggcggcgaaggccggcgcatggggccgctg
ggacgcggcaggctcaagccgctggtgccgttcggcggtacctcccggctcatcgatttc
agcatcgccaacgttcaccggtcgggcctgcgggacgtcctgctgctgtcgcagtacgag
gagcgccgcctcatggacgatctgcacctggtctggaacgggcgccaccgcggcttccgg
atagatttcggcccctatgacgcggtgtaccggcgctcaccgggcaagctgcccgagcaa
ctgccggagcgcacttggccgttggaacgcggcacagccgacgcgctgctcaccaaggcc
gagtacgtcttcaggcagggtgacgcagaggcctcggagatcctcgtgctccacgcggac
cacgtctaccgtttcgactacggcgacatgatccgcgagcaccgcgcgtccaaggccgcg
ctgacagtgtcgtaccagcgcatcgagcggcggtacgtgcaccttttcggcatggtcgag
ttcgacggggacggcctgctcacagcgttcgaggagaagcctgacgaccccacgagcgac
ctggtgttcgccgccttctgcctcttcgacgcggcgaccctgcggcgttacctggagcaa
ctgcgcggcacggattggcagcacgacatcagcagggacgtcatcccggcgatgctggcg
ggcggcgaactcatccgcgggtatgaggtcaagagctactgggaggacatcggcaccgtg
gaccgctaccaccgcgcccatcgcggactgctgcgggccgatccgacgctcgcgttgagc
gacatgccgctgaccgtcgcccccgaggtgccacggcacctcgtcccgggcgggcccggc
cggcgtgccagcgtcgtggcggccgacgtggcgaacgagggcgagatcgtgagcagcgtg
gtgtacccgggcgcacgcatcggtgttgacgcacacgtggtcgactgcgtcgtgctgcca
ggtgcccaggtaccggacggaacacacctggcgtcggccatcgtgctggaggacggctcc
gtccagcagtgcgaggcggagcgggaagaggtggcgctgtga

DBGET integrated database retrieval system